The GalNet Archive - 10th Sep 3306 - ?

Welcome to The GalNet Archive.

This is as much for my own use as anybody else's, I know they're elsewhere but they don't seem to be on one easy accessible page so I'm putting them on here for future reference.

This Archive only covers from the return of GalNet on 10th September 3306 (2020).

I have reserved 1st 5 posts for future archives, not sure how long one post can be. Everything spoilered for speed and space. Hope its of use to someone else as well as me. Enjoy reading :)

Appendices currently in Post #3

TERRORIST ATTACKS ON IMPERIAL STARPORTS
Pilots Federation ALERT: For the attention of all Commanders
The Empire has broadcast this message across its emergency channels:
“There have been multiple explosions within Mackenzie Relay station, in Princess Aisling Duval’s home system of Cemiess. NMLA terrorists have claimed responsibility.”
“In coordinated attacks they have also struck at Tsiolkovsky Terminal in the Gabjaujis system, Garrido Market in the LHS 4031 system, and Muller Terminal in the Rabh system.”
“We urgently request assistance from the galactic community with repairing these starports and rescuing their populations.”
The Imperial Internal Security Service issued a bulletin regarding this current threat:
“The Neo-Marlinist Liberation Army (NMLA) is a paramilitary force of political extremists, whose activities have been small-scale until now.”
“Marlinism is a well-known ideology inspired by Marlin Duval, who established the Republic of Achenar in the 23rd century prior to it becoming the Empire. Many people in the fringe systems are Marlinists, who want to replace hereditary Emperors with representation by elected senators. Neo-Marlinism is a more radical conviction that only terror tactics will force such change.”
“The NMLA’s hatred of the Imperial Family explains why it has targeted starports under the Duval banner. But its use of portable military-grade explosives is unprecedented, suggesting an increase in resources.”

STARPORT UPGRADE INITIATIVE TO SUPPORT FLEET CARRIERS
A press release from Brewer Corporation discusses plans to improve access to refuelling for owners of fleet carriers.
“We have been surprised and gratified by the popularity of our latest product. The options for independent pilots and crews have been considerably expanded by the versatility and capability of our Drake-Class Carriers.”
“But we have also listened to customers’ concerns, in particular that large ships such as Anacondas, Corvettes and Clippers cannot dock with refinery outposts to take on Tritium fuel.”
“To help alleviate this issue, Brewer Corporation has partnered with two independent construction firms: Kavanagh Spaceframes Ltd and Steel Castle Inc. They are tasked with upgrading a number of outposts into fully functioning starports, in order to make refuelling runs more efficient.”
The two construction companies that won this contract both have impressive track records in modifying orbital habitats. Kavanagh Spaceframes specialises in Orbis starports, while Steel Castle exclusively works with Coriolis designs. The projects are expected to begin next week.

Inquiry into Starship One’s Destruction Concludes

An independent inquiry by the Federal Attorney’s Office into the destruction of presidential vessel Starship One has produced a final report.

Senior Attorney Milandu Okoro made this statement:

“The loss of presidential vessel Starship One in May 3301, along with hundreds of lives, was a great tragedy. Despite suspicion that this was an attempt to eliminate then-President Jasmina Halsey, initial investigations concluded that a catastrophic malfunction of its drive systems was the likely cause.”

“A new inquiry was opened when fresh evidence came to light, including testimonies from several members of the Federal Navy. Our final report states that there is sufficient reason to believe Starship One was destroyed by deliberate sabotage.”

“A grand jury has determined that criminal charges should be made. We have shared our findings with the Federal Intelligence Agency, and understand that an arrest will take place shortly.”

The inquiry report is not yet in the public domain, but is thought to allege that illegal modifications were made to the Frame Shift Drive system of Starship One in advance of its destruction during flight through hyperspace.

The Imperial Internal Security Service has transmitted another urgent bulletin regarding terrorist attacks on starports in the Empire.

“There have been indications that the four starports came under attack by Thargoids. We can confirm that this is not the case, and there is no evidence of Thargoid vessels in the vicinity.”

“Observers reported that some of the damage inflicted on the stations’ infrastructure closely resembled the effect of Thargoid weaponry. This was registered by internal sensor systems, resulting in automatic emergency broadcasts designed to summon aid during a Thargoid incursion.”

“Preliminary investigations suggest the use of customised explosive devices that incorporated elements of Thargoid technology. This suggests that the perpetrators have access to unusually sophisticated resources as well as xenological materials.”

“As yet there is no reason to doubt that the Neo-Marlinist Liberation Army (NMLA) is responsible for these attacks. We have received reports of jubilant scenes from some Imperial fringe systems, in territories where Marlinism remains popular.”

Help with rescue operations is still being requested from the four Imperial starports: Mackenzie Relay in the Cemiess system, Tsiolkovsky Terminal in the Gabjaujis system, Garrido Market in the LHS 4031 system, and Muller Terminal in the Rabh system.

Prince Harold Duval Assassinated

Prince Harold Duval is dead after a targeted assassination attempt by the Neo-Marlinist Liberation Army.

The Empire has imposed a media blackout on these events, and no official statement has been made. However, independent journalist Gwendolyn Nash published this on-the-scene report for Vox Galactica:

“From interviewing multiple sources, we gather that a single assassin managed to infiltrate Harold Duval’s personal transport. He was killed by shipboard guards but not before shooting the Prince at close range.”

“The NMLA claimed responsibility for this attack in its latest propaganda broadcast, which referred to the Duval family as ‘imperialist parasites’. The extremist group also demanded that ‘Marlinists everywhere must rise up and demand a democratic Republic’.”

“Harold Duval was famously declared unfit for the throne by Emperor Hengist, and has been out of the public eye ever since. He rarely left Capitol but was making an unpublicised journey to visit his daughter Aisling Duval, presumably in response to the recent terrorist attack in the Cemiess system.”

“It remains unknown how the NMLA knew of the Prince’s itinerary, or managed to breach security on his ship.”

Community Support Required for Starport Conversions

Pilots Federation ALERT: For the attention of all Commanders

Trading commodities required in Nagasairu and Tenche systems.

Two construction companies have requested materials to convert refinery outposts into starports, to assist owners of fleet carriers who use large vessels for tritium refuelling.

Susannah Haynes, CEO of Kavanagh Spaceframes Ltd, stated:

“With the galactic community’s help, we can upgrade a maximum of five outposts into Orbis starports. Our intermediaries, Tenche Universal Holdings, will accept deliveries of building fabricators, power generators and thermal cooling units at Blaauw Hub in the Tenche system.”

There were similar requests from Dean Bradigan, director of Steel Castle Inc:

“For travellers who find the familiar sight of Coriolis stations welcoming, here’s a chance to build up to five more. We ask for shipments of bauxite, gallite and rutile to be delivered to CQC Holdings at Teng-hui Station in the Nagasairu system.”

The number of starports will depend on the amount of materials delivered. The target systems in order of priority are Fjorgyn, HR 4979, Wolf 294, Lambda-2 Tucanae, Potriti, LHS 4058, Chakpa, Gally Bese, Eta Cephei and Ninabin. If successful, upgrading will be done for the start of October.

Both initiatives begin on 17th September 3306 and will run for one week. If the final targets for a campaign are met earlier than planned, it will end immediately.

Arrest Made in Starship One Criminal Case

An officer in the Federal Navy Engineering Corps has been arrested for sabotaging the presidential vessel Starship One.

A statement was made by Milandu Okoro of the Federal Attorney’s Office:

“Chief Technician Rory Webster was a department head of engineering for Starship One. Testimonies from members of Mr Webster’s team claim that he ordered unauthorised adjustments to the ship’s hyperdrive systems while in drydock, shortly before its launch in May 3301 and subsequent destruction.”

“This case is now being brought before the Federal High Court, where Mr Webster will stand trial for mass murder and attempted treason.”

There has been no comment from President Zachary Hudson, but Shadow President Felicia Winters told the press:

“This was a truly horrific tragedy, and there must be justice for all those who lost their lives on that sad day.”

The apparent death of many Federation leaders aboard Starship One resulted in Winters briefly becoming acting president, shortly before Hudson won a vote of no confidence. There has been much media attention regarding how this event proved pivotal to both of their political careers.

Successful Initiatives to Produce New Starports

Pilots Federation ALERT: For the attention of all Commanders

New starports to be constructed in 10 systems.

Two projects to resource the upgrading of refinery outposts into starports have concluded. The aim is to increase efficiency for fleet carrier owners who use large ships for transporting tritium fuel.

Kavanagh Spaceframes Ltd published this statement from CEO Susannah Haynes:

“Thanks to a generous number of deliveries, we will have in place fully functioning Orbis starports for the start of October in the Fjorgyn, HR 4979, Wolf 294, Lambda-2 Tucanae and Potriti systems.”

“All participating traders can now collect their rewards at Blaauw Hub in the Tenche system.”

A similar announcement came from Dean Bradigan, director of Steel Castle Inc:

“The many shipments that we received will enable us to provide new Coriolis stations in the LHS 4058, Chakpa, Gally Bese, Eta Cephei and Ninabin systems by the beginning of October. We hope these will provide services to travellers for many years to come.”

“Rewards for all pilots who delivered these minerals are now available at Teng-hui Station in the Nagasairu system.”

Obituary: Prince Harold Duval
21 SEP 3306
The Imperial Herald has published an obituary of Prince Harold Duval, who was assassinated by NMLA terrorists.

“Born in 3230 to Emperor Hengist, Harold Duval reacted against his father’s puritan lifestyle by filling his days with partying and debauchery, becoming the black sheep of the Duval family.”

“It was probably accidental that Harold had a child with entertainer Imogen Gabrielini, but they married shortly before her narcotics-related death. His daughter, Princess Aisling Duval, has always spoken warmly of her loving father.”

“Emperor Hengist eventually decreed that his son was not fit for the throne, despite being his only heir. Harold never contested this, perhaps relieved to allow half-sister Arissa Lavigny-Duval to take his place.”

“In recent years Harold became a recluse on Capitol, suffering ill-health from a lifetime of excesses. But a father’s protective instinct motivated him to travel to Aisling’s home system after it was attacked. Tragically, despite always renouncing power, merely being a Duval made him a target to those same republican terrorists.”

“As the Empire mourns Prince Harold, suspicions arise that the NMLA were aided by inside knowledge of his ship’s itinerary and security, throwing an uneasy shadow over the legacy of this eccentric, endearing man.”

State Funeral Held for Prince Harold Duval

24 SEP 3306
Pilots Federation ALERT: For the attention of all Commanders

Rare commodities required by the Empire in the Baal system.

The state funeral of Prince Harold Duval has begun on Capitol. An official week of mourning has been declared throughout the Empire.

Emperor Arissa Lavigny-Duval opened the ceremony, delivering a eulogy for her half-brother. Princess Aisling Duval, Harold’s daughter, was also in attendance but was too emotional to address the huge crowds.

Messages of condolence from across the galaxy were on holographic display, including from Alliance Prime Minister Edmund Mahon and Federal President Zachary Hudson. Even Hadrian Duval, the exiled leader of Nova Imperium, paid respects to his late uncle.

The body of the Prince, contained within a jewelled transparent casket, was paraded through the city by a company of Imperial Guard. It will remain in state for two weeks prior to internment in the Hall of Martyrs.

The Imperial Palace will host a memorial ceremony to honour Harold Duval, for which rare commodities have been requested before Thursday 1st October. Ngadandari Fire Opals, Esuseku Caviar, Lavian Brandy and Kamitra Cigars should be delivered to Oterma Station in the Baal system, where the White Templars will transport them to Capitol after security vetting.

Commanders of the Pilots Federation will be assigned an Achenar system permit alongside financial rewards. To further encourage participation, Gutamaya Corporation will apply a discount of up to 25% for all ship purchases according to the amount of rare items provided.

Starship One Trial Begins

The trial of Chief Technician Rory Webster, who is charged with mass murder and attempted treason, began today at the Federal High Court on Mars.

Mr Webster, a department head in the Federal Navy Engineering Corps, is accused of attempting to destroy Starship One in 3301. He has filed a plea of not guilty.

The prosecutor laid out the charges, including this summary:

“According to the testimonies of three naval engineers, they installed replacement power regulator components to Starship One prior to its launch. Mr Webster verified this was routine maintenance during the initial investigation.”

“Last year, one engineer reviewed data for the Highliner Antares incident and realised that pre-modified power regulators could have caused an identical Frame Shift Drive misjump on Starship One. She tried to trace the components’ source and found the records deleted.”

“After Mr Webster refused to respond to her questions, she and her colleagues contacted the authorities, prompting a full inquiry.”

The Highliner Antares was a Sirius Corporation passenger liner that was destroyed in 3251 when its experimental hyperdrive engines malfunctioned.

The defence refuted the accusations as unprovable and motivated by personal grudges, making reference to Chief Technician Webster’s otherwise flawless record.

The trial is expected to conclude next week.

Imperial Crackdown on Marlinists
30 SEP 3306
Senator Denton Patreus has mobilised Imperial military forces in response to terrorist acts committed by the Neo-Marlinist Liberation Army (NMLA).

The Empire has declared martial law and a lockdown in Ackwada, Beatis, Chana and Nahuatl, where the republican ideals of Marlinism are known to be popular. Imperial Army troops have replaced local security forces, and potential NMLA sympathisers are being arrested for interrogation.

Senator Patreus received applause in the Imperial Senate when he vowed:

“There will be justice for the murder of Prince Harold Duval and justice for those citizens who perished in flames. The Marlinists will pay dearly for these atrocities!”

In related news, the Imperial Internal Security Service issued a report regarding the NMLA’s recent attacks on starports:

“Forensic results confirm that much of the station damage was caused by Thargoid caustic enzymes. Fragments indicate that the bombs were of advanced design but definitely man-made, not Thargoid in origin. Their payloads were identical in composition to enzyme missile rack warheads.”

“Our deduction is that the portable explosives were smuggled onto all four starports, then remotely detonated as one coordinated strike. We are interviewing station personnel and analysing recent traffic to identify any patterns.”

New Starports Become Operational
01 OCT 3306
Pilots Federation ALERT: For the attention of all Commanders

New starports constructed in ten systems causing increased commodity demand.

Several refinery outposts have now been upgraded to starports, following an initiative to improve access to large ships for refuelling fleet carriers.

Kavanagh Spaceframes Ltd has completed construction of the following Orbis starports:

Harper Plant in the Fjorgyn system
Iqbal Hub in the HR 4979 system
Stephenson Dock in the Wolf 294 system
McQuarrie Landing in the Lambda-2 Tucanae system
Hartsfield Plant in the Potriti system

The following Coriolis starports have been constructed by Steel Castle Inc:

Rorschach Hub in the LHS 4058 system
Chargaff Installation in the Chakpa system
Nagata Vision in the Gally Bese system
Reilly Plant in the Eta Cephei system
Trevithick Vision in the Ninabin system

As a result of the community drives to build these starports, there have been fluctuations on the trading market. The availability of several commodities has been reduced, resulting in increased prices and profit margins. The items affected include:

Bauxite
Building fabricators
Gallite
Power generators
Rutile
Thermal cooling units

Rare Goods Delivered for Harold Duval’s Memorial Ceremony
01 OCT 3306
Pilots Federation ALERT: For the attention of all Commanders

Memorial preparations complete.

A request by the Empire to honour the passing of Prince Harold Duval with rare items has received an impressive response, earning the gratitude of the Imperial Family.

Shipments of Ngadandari Fire Opals, Esuseku Caviar, Lavian Brandy and Kamitra Cigars were transported to the memorial ceremony at the Imperial Palace on Capitol. The body of the Prince will remain in state for another week, prior to reaching its final resting place within the Hall of Martyrs.

Pilots who delivered these commodities can now collect their rewards at Oterma Station in the Baal system.

Achenar system permits will be processed and automatically allocated by the 3rd of October 3306.

In recognition of this achievement, Gutamaya Corporation ships will be available at a 20% discount from the 2nd of October 3306 to the 9th of October 3306.

Princess Aisling Duval told the media:

“I wish to thank everyone for their kindness during this difficult time. I’ve taken much comfort from knowing that my father will never be forgotten.”

“For now, I want to make it clear that all efforts to eliminate the brutal terrorists responsible for his death have my full support. I urge every citizen to reject the destructive dogma of Marlinism and work together for a stronger Empire.”

Engineer Linked to Terrorist Weapons
01 OCT 3306
Pilots Federation ALERT: For the attention of all Commanders

Conflict between Keltim Empire League and Eurybia Blue Mafia in the Eurybia system.

Explosive devices used in recent terrorist attacks on four Imperial starports have been linked to Liz Ryder, an engineer based in the Eurybia system.

The Imperial Internal Security Service published this report:

“Analysis of station traffic revealed that the explosives were delivered on cargo transports linked to the Eurybia Blue Mafia, a notorious anarchist organisation that we have reason to believe is secretly supplying the NMLA.”

“The Eurybia Blue Mafia is protecting demolitions expert Liz Ryder, who we strongly suspect designed the specialist weapons used in the starport bombings. As they have refused to cooperate, a state of war has been declared until she is surrendered to our custody.”

“Our affiliate faction, the Keltim Empire League, has requested the support of independent pilots against any resisting anarchist forces.”

Ana Westergard, a spokesperson for the Eurybia Blue Mafia, broadcast this emergency message:

“This is an outrageous invasion by the Empire! We categorically deny any involvement with the NMLA. I urgently call upon our supporters – and anyone who cares about freedom – to help us defend Liz Ryder as well as our independence.”

Engineering services are still available at the Demolition Unlimited workshop, with Liz Ryder communicating remotely from a place of safety.

Revelation Halts Starship One Trial
05 OCT 3306

The Federal High Court trial over the destruction of Starship One has been temporarily halted following a proffered confession from the defendant.

Chief Technician Rory Webster is charged with mass murder and treason, with testimonials claiming that he ordered his engineering team to sabotage Starship One’s hyperdrive systems.

Crime correspondent Ethan Takahashi reported for The Federal Times:

“Despite a spirited performance from the defence, highlighting the absence of a sufficient motive, Mr Webster visibly struggled in the dock last week as the technical evidence mounted. Several jury members nodded when the prosecutor called for the death sentence, should the accused be found guilty of slaughtering hundreds.”

“The judge was about to begin her summation, when Mr Webster’s defence counsel announced that the defendant now wished to change his plea to guilty and make a full confession in return for clemency, claiming that he had acted on ‘orders from the top’.”

“There was much discussion between the judge and legal representatives. Eventually it was agreed that the trial would be suspended while Mr Webster’s testimony was taken by the Federal Intelligence Agency, and then a suitable course of action would follow.”

The Federal Attorney’s Office stated that a decision on resuming the trial is expected within a few days.

Eurybia Blue Mafia Resists Imperial Forces

08 OCT 3306
Pilots Federation ALERT: For the attention of all Commanders

Conflict between Keltim Empire League and Eurybia Blue Mafia in Eurybia has ended.

The Eurybia Blue Mafia has successfully fought off an attempt by the Empire to take the Engineer Liz Ryder into custody.

Spokesperson Ana Westergard made this announcement on behalf of the anarchist faction:

“This is a victory against the Empire’s arrogance! There was never any evidence that Liz Ryder or our organisation are involved with terrorists, and this invasion was based entirely on supposition.”

“We are extremely grateful to everyone who helped us defend Liz Ryder and maintain our independence. Rewards to all those brave Commanders are available at Awyra Flirble starport, modules will be placed in storage by the 10th of October 3306”.

Captain Rocco Gandara of the Keltim Empire League announced:

“Despite the anarchists having the upper hand on this occasion, I can confirm that we will honour all of our supporting pilots by making rewards available at Prelude to Victory.”

Military Strike Against Marlinist Faction
08 OCT 3306
Pilots Federation ALERT

Conflict between Regulatory State of Ackwada and Duduseklis Empire League in the Ackwada system.

The Empire has targeted a Marlinist faction that is suspected of supporting the Neo-Marlinist Liberation Army (NMLA). It was recently placed into lockdown for its pro-Marlinist stance, during which time suspicions were raised of it having a direct connection to the NMLA.

The Imperial Internal Security Service made this statement:

“The Duduseklis Empire League is one of several organisations that publicly accepted the principles of Marlinism. Our intelligence suggests it is allowing the NMLA to radicalise its citizens into becoming activists for the paramilitary group.”

“Operations to investigate this potential nest of terrorists have been met with armed resistance. Imperial auxiliaries and independent pilots are requested to assist the Regulatory State of Ackwada in defeating all pro-Marlinist forces in the Ackwada system.”

The Duduseklis Empire League broadcast this message:

“If NMLA members have been recruited from our people, it is certainly not with our knowledge. The Empire is using a terrorist hunt to justify persecuting millions of ordinary citizens, whose only crime is to believe in republican ideals.”

“We remain loyal to the Emperor, but are forced to counter this unwarranted aggression to ensure these political refugees escape imprisonment. The stronger our resistance, the more megaships can flee this system. We desperately need help so we can transport thousands of innocent families to safety.”

Fleet Admiral Vincent Named as Starship One Saboteur
09 OCT 3306
Fleet Admiral Lucas Vincent, one of the Federal Navy chiefs of staff, has been arrested on charges related to the destruction of Starship One.

The trial of Chief Technician Rory Webster was halted by a plea bargain to reveal who ordered him to sabotage Starship One’s hyperdrive in 3301.

An update on proceedings was delivered by Milandu Okoro of the Federal Attorney’s Office:

“Mr Webster provided evidence that Fleet Admiral Vincent directly commanded him to arrange for Starship One to suffer the same fate as the Highliner Antares. The orders were allegedly provided on a private channel, accompanied by threats discouraging Mr Webster’s refusal.”

“The trial concluded with the judge summarily convicting the defendant of aiding and abetting mass murder. Chief Technician Webster received a lenient sentence of 20 years in prison, in acknowledgement that he performed criminal acts under duress.”

“The FIA has detained Vincent in a high-security facility, and he has been charged with conspiracy to commit murder and treason. However, the case is likely to take several months to come to trial.”

There was no comment from President Zachary Hudson, who is believed to be a personal friend of Vincent. A spokesperson for his administration said: “As always, the President has full confidence in our court system to deliver justice.”

Engineer Reveals Link to Terrorist Bombs
12 OCT 3306
Liz Ryder, an engineer based in the Eurybia system, has confirmed that her designs for an explosive match those used by NMLA terrorists against Imperial starports.

Her statement was distributed by Vox Galactica:

“Under a private contract from what appeared to be the Eurybia Blue Mafia, I designed demolition charges capable of delivering a secondary payload. At no point did I know these would be customised to hold Thargoid caustic enzymes or used in terrorist activities. Until recently, I had no idea that the starport bombings were caused by modified versions of my design.”

“I have since discovered that my contractors used false identification, and now seem to be untraceable. It appears that the NMLA, or people working for them, infiltrated the Eurybia Blue Mafia to access my services.”

“To help clear the Eurybia Blue Mafia, which has supported me for years, I have provided Imperial investigators with all the data I have regarding this contract. I urge the Empire to accept that we were all deceived by the terrorists.”

The Imperial Internal Security Service confirmed that the warrant for Liz Ryder’s arrest has been rescinded and it is reviewing her information, which may lead to locating the source of the Thargoid enzymes used in the bombs.

Marlinist Faction Blockaded by Empire
14 OCT 3306
Pilots Federation ALERT

Conflict between Regulatory State of Ackwada and Duduseklis Empire League in the Ackwada system has concluded.

A Marlinist faction accused for providing recruits to the NMLA terrorist group has been overwhelmed by a combination of Imperial forces and independent pilots. Several megaships were intercepted while attempting to transport large numbers of Marlinist civilians out of the Ackwada system.

This report was delivered by the Imperial Internal Security Service:

“We have taken many Marlinist criminals into custody, despite their efforts to shield the terrorists. Some may have temporarily evaded us, but we are confident that we can track and destroy the NMLA cells operating within this system.”

“Our affiliate, the Regulatory State of Ackwada, will distribute rewards at Glorious Destiny to all who contributed to this victory.”

The Duduseklis Empire League broadcast this message to its supporters:

“Thousands of political refugees attempted to flee from persecution onboard megaships. Unfortunately, the Imperial blockade was supported by too many independent pilots, and none were able to escape.”

“Despite being unable to help our Marlinist supporters, we are still able to offer rewards at Rush's Camp for the brave few who dared to dream of democracy.”

Imperial scouts are currently searching for many smaller vessels that fled the system and may contain NMLA activists.

Thargoids Return to Witch Head Nebula
15 OCT 3306
Pilots Federation ALERT

Thargoid vessels detected in Alliance-controlled systems within the Witch Head Nebula.

The Thargoids have reappeared in the Witch Head Nebula, and are swarming in large numbers through the Onoros, Lembass, Haki, Wellington and Shenve systems.

Sixteen systems within the nebula were colonised last year to form the Witch Head Enclave, after a successful initiative to locate fresh barnacle sites. This initially triggered a hostile reaction from the Thargoids, but their presence was relatively low until now.

Captain Warren Lamar, head of security for the Alliance Expeditionary Pact, put out an urgent call for assistance:

“If this Thargoid assault is not repelled, it may spread into a full-scale invasion throughout the Witch Head Enclave. Neither Aegis nor the Alliance Defence Force are able to deploy in time, so we ask all independent combat pilots and anti-xeno squadrons to come to our defence.”

The Alliance Expeditionary Pact has confirmed that it will offer generous rewards to all Commanders who assist with destroying Thargoid vessels.

In related news, the technology broker at Bray Landing in the Yuanjia system will support pilots by reducing resource requirements to access Guardian weapons and modules.

Marlinist Exodus as Imperial Lockdowns Continue
16 OCT 3306
The Empire has locked down more systems as part of an anti-terrorism operation, causing millions of Marlinists to flee from their homes.

Following NMLA terror attacks, martial law was declared in regions where the political beliefs of Marlinism are prevalent.

Citizens in several systems including 234 G. Carinae, Baltah'Sine, Beatis, CD-39 3269, Chana, HIP 39470, Mazahuanses and Nahuatl have evacuated en masse to avoid arrest. There are eyewitness reports of people crammed into whatever vessels they can find, often in unsafe numbers.

Vox Galactica featured this statement from Dr Jenna Fairfax, a Marlinist community leader and advocate of democratic reform:

“This isn’t a search for terrorists – it’s a crusade against anyone who shares Marlin Duval’s dream of a Republic. Such brutal persecution leaves us no choice but to risk our lives by seeking sanctuary elsewhere.”

In the Senate, a handful of senators voiced concerns about the treatment of Imperial citizens, to which Denton Patreus responded:

“The security of the Empire is paramount. These worlds harbour a ruthless enemy that has already slaughtered thousands. We will not rest until the Neo-Marlinist poison has been cleansed, even if that means tracking down everyone who may carry this infection.”

The Imperial Navy is searching for all ships transporting Marlinist refugees, but there is evidence that some have reached systems controlled by the Federation.

Political Turmoil for President Hudson
19 OCT 3306
Political support for Federal President Zachary Hudson has plummeted after the results of a trial concerning Starship One’s destruction.

Fleet Admiral Lucas Vincent was charged with sabotaging the presidential vessel, leading to hundreds of deaths. His close relationship with Hudson has triggered a public outcry and accusations of a conspiracy to assassinate then-President Jasmina Halsey.

Political analyst Vihaan Niven reported on the situation:

“The Republican Party is officially in a state of crisis. President Hudson has refused to make any statement regarding Fleet Admiral Vincent, despite pressure piling up from all corners of the Federation. Over a dozen congressmen have resigned in protest, refusing to be associated with what some newsfeeds are calling ‘the crime of the century’.”

“Shadow President Felicia Winters has stopped short of making direct allegations against Hudson but, in several powerful speeches, she stressed that no elected ruler can ever be above the law.”

“Opinion polls suggest that the Liberal Party now has majority support for the first time in years, and that many people view Hudson as a symbol of corruption. In 3305, halfway through his term of office, the President won the scheduled congressional vote of no confidence by a slim margin. It is doubtful that his administration would survive if it were to be held today.”

Marlinist Refugees Flee to the Federation
20 OCT 3306
The Empire has formally demanded that the Federation extradites all Marlinist political refugees that have fled into their space.

Hundreds of thousands of believers in the republican ideology evacuated their homes following anti-terrorism lockdowns. The Imperial blockade in Ackwada prevented ten megaships from escaping, but others carrying huge numbers of Marlinists have appeared in the Federal systems Charunder, Ennead, HIP 36081, LTT 1935, LTT 3607 and Thetis. Many smaller vessels are also thought to have spread far and wide.

Imperial Ambassador Imogen Luciana sent the formal request:

“The Federation is harbouring potential criminals who are connected to the NMLA terrorists. We insist that they are detained and returned to us to face justice.”

Federal Ambassador Jordan Rochester, who was once engaged to Princess Aisling Duval, provided an official response:

“There is no extradition treaty for unconvicted citizens, and these people have claimed political asylum. I have requested that Congress grant them sanctuary within the Federation, and that we offer protection to all Marlinists seeking to escape discrimination by the Empire.”

Although there is no indication that Marlinist emigrants have set course for Alliance space, Prime Minister Edmund Mahon confirmed that they will be welcomed. Some independent systems are also offering assistance, while others have warned that any influx of refugees will be resisted.

Thargoid Incursion Repelled in Witch Head Enclave
21 OCT 3306
Pilots Federation ALERT

Thargoid forces defeated in an Alliance-controlled system within the Witch Head Nebula.

The galactic community has responded to a call for aid from the Witch Head Enclave and successfully resisted an attack by the Thargoids. The majority of the alien vessels were destroyed, forcing the remainder to retreat.

Captain Warren Lamar, head of security for the Alliance Expeditionary Pact, announced:

“Everyone in Onoros and our neighbouring systems owes an enormous debt to the courageous pilots who met the Thargoids in battle. The whole of the Witch Head Enclave is breathing a sigh of relief that this resurgence was prevented from spreading any farther.”

The Alliance Expeditionary Pact offered financial rewards for those who took part in the system’s defence, and these payments can now be obtained at the Golden Stag.

To help celebrate this victory, the technology broker at Bray Landing in the Yuanjia system confirmed that access to Guardian weapons and modules will stay reduced for one more week.

Federal Initiative to Support Marlinist Refugees
22 OCT 3306
Pilots Federation ALERT

An aid charity is requesting deliveries of vital supplies to help Marlinist refugees that fled from the Empire to the Federation.

Safeguard Interstellar, a humanitarian aid organisation, has announced a campaign to help refugees requesting political asylum in the Federation.

Several Imperial factions sympathetic to Marlinism were placed under martial law, leading to civilians emigrating in huge numbers to the Federal systems Charunder, Ennead, HIP 36081, LTT 1935, LTT 3607 and Thetis. Local authorities have warned that without additional support, these refugees may trigger public unrest or food shortages. There is also a risk of unfamiliar contagions reaching the population.

Noel Beaumont, the CEO of Safeguard Interstellar, made this statement:

“These ex-citizens of the Empire have suffered at the hands of their own government, and now seek freedom from persecution. Shelter, food and other necessities must be provided to satisfy their basic human rights.”

“We urgently require shipments of basic medicines, clothing, food cartridges, fruit and vegetables, and evacuation shelters to Fox Enterprise in the LFT 625 system. From there, they will be distributed to the Marlinists. The more supplies we receive, the more systems can offer sanctuary without strain on their infrastructure.”

Safeguard Interstellar’s affiliate, the Fionn Liberals, has offered to pay handsomely for all bounty vouchers collected from wanted vessels in the LFT 625 system.

The initiative begins on the 22nd of October 3306 and will run for one week. If the final target is met earlier than planned, the campaign will end immediately.

Congress Votes to Accept Marlinist Immigrants
26 OCT 3306
The Federation will grant sanctuary to Marlinist political refugees from the Empire, following a congressional vote in favour of Felicia Winters.

President Zachary Hudson had stated that illegal immigrants in the Federal systems Charunder, Ennead, HIP 36081, LTT 1935, LTT 3607 and Thetis would be detained and returned to Imperial space. This was challenged by Shadow President Felicia Winters, who argued that they deserved a more compassionate response.

Congress debated and then voted on her proposal, which received majority support. Government funding will soon be released to provide resources and accommodation for the refugee population.

Shadow President Winters told the media:

“Charities such as Safeguard Interstellar are already doing excellent work, but now we can officially offer safe haven and temporary citizenship to all Marlinists.”

“These innocent people only seek what we in the Federation take for granted – democracy, fairness and political representation. Their values are closer to ours than the Empire’s, and we have an obligation to protect them.”

Several newsfeeds, including The Federal Times and Sol Today, commented that President Hudson’s authority has been undermined by his refusal to comment on the charges against Fleet Admiral Vincent. The accompanying rumours of corruption and conspiracy have had a demoralising effect on his supporters, and increased the Liberal Party’s popularity.

Terrorist Hit Squad Targets Hadrian Duval
27 OCT 3306
Imperator Hadrian Augustus Duval has been severely wounded in an assassination attempt by Neo-Marlinist extremists.

The attack took place at Dyson City in the Paresa system, headquarters of the isolationist organisation Nova Imperium. A small team of armed intruders broke into the command deck and opened fire. Three people were killed and four injured, including Hadrian Duval, before his Praetorian Guard eliminated the assassins.

The NMLA has claimed responsibility. On propaganda channels, the paramilitary group vows to “sever every head of the Duval hydra”, and calls for all citizens to rise up and demand democracy.

Praetor Leo Magnus, Nova Imperium’s head of security, gave this statement to Vox Galactica:

“The Imperator is in a critical condition but receiving our finest medical care. I am personally overseeing an investigation into how the NMLA infiltrated our starport and bypassed security checks.”

“Such attacks are as sickening as they are cowardly, and Nova Imperium stands firmly against these terrorists.”

Hadrian Duval is the illegitimate grandson of Emperor Hengist. His father, the late Commander Hector Jansen, was the result of a secret liaison with a household slave. Although disowned by the Imperial Family, Hadrian claims to be a rightful heir to the throne.

‘Ghost Ship’ Arrives in Chukchan System
29 OCT 3306
Pilots Federation ALERT

An abandoned megaship that set out two centuries ago has returned on automatic pilot to the Chukchan system.

Local security forces were scrambled to intercept an unidentified vessel that was detected on a collision course with Chukchan 5 B.

The megaship displayed no signs of life, so tugs were deployed to wrench it into a safe orbit. This caused onboard power systems to overload with explosive results, damaging cargo holds and spilling debris.

The name of the ship was confirmed as the Adamastor, but no further information is available in the public domain.

Specialists from the Alliance Salvage Guild boarded the derelict to conduct an investigation. Their preliminary report stated:

“The Adamastor has been travelling at sublight speed through interstellar space for nearly two hundred years. There are no remains of the crew. All escape pods and secondary craft have been launched, and several airlocks were manually opened from within.”

“A complete absence of identification suggests that this ship was intended for clandestine operations. All data drives have been deliberately erased.”

“There is evidence of a reinforced cargo hold, fitted with what looks like the remains of environmental equipment. Recent fire damage makes it impossible to be more specific.”

“The ship’s original destination is unknown, having returned to its launch point on autopilot. Calculating its trajectory implies that it passed near the HIP 61595, HIP 64011 and HIP 65201 systems.”

The Adamastor will remain in orbit for further examination.

Supplies for Marlinist Refugees Successfully Delivered
29 OCT 3306
A Federal charity initiative to deliver vital supplies for Marlinist refugees from the Empire has concluded.

Safeguard Interstellar, a humanitarian aid organisation, received an impressive response to its request to provide basic necessities to Marlinist immigrants claiming asylum in the Federation.

CEO Noel Beaumont announced:

“These much-needed shipments of basic medicines, clothing, food cartridges, fruit and vegetables, and evacuation shelters will be used to sustain the Marlinist populations in the LTT 3607, Charunder and Ennead systems, at least until they can receive the state support granted by Congress.”

“Our affiliate, the Fionn Liberals, will be pleased to reward contributing pilots at Fox Enterprise in the LFT 625 system.”

The charity shared a message from Dr Jenna Fairfax, a Marlinist community leader:

“To all the pilots who brought these life-saving supplies – thank you. Leaving our homes has been incredibly difficult, but you and Safeguard Interstellar have provided ports in the storm. Many of us hope to start afresh in the Federation, where we know our democratic ideals will be nourished.”

Empire and Federation Clash Over Marlinists
30 OCT 3306
The Empire has repeated its demand for the Federation to deport all Marlinist emigrants, as tensions increase between the two superpowers.

Hundreds of thousands of political refugees reached Federal space after fleeing to escape the Empire’s hunt for Neo-Marlinist terrorists. Congress has agreed to provide sanctuary, along with offers of permanent residency.

Imperial Ambassador Imogen Luciana stated:

“Our people must be safely returned so we can identify dangerous NMLA activists, before they gain the opportunity to inflict further harm. We have no desire for the Federation to suffer the same horrific attacks.”

A response was given by Federal Ambassador Jordan Rochester:

“As always, the Empire promises one thing and does another. This is not an altruistic effort to spare us from terrorists – it is a totalitarian purge of believers in democracy.”

There are reports that both superpowers have suspended many official channels of communication. Political commentators have observed that the Federation’s actions could be construed as the mass kidnapping of Imperial citizens, which would be an act of war.

Hadrian Duval Saved by Aisling Duval’s Intervention
02 NOV 3306
Princess Aisling Duval has provided lifesaving aid to Imperator Hadrian Augustus Duval, who was severely wounded by NMLA terrorists.

The INV Achenar's Courage, transported her to the Paresa system where she offered protection against further assassination attempts.

Hadrian Duval was transferred to the Majestic-class Interdictor’s medical bay, surrounded by both his Praetorian Guard and Imperial troops. He received advanced treatment including Vitadyne nanomeds, and is no longer in critical condition.

This unorthodox intervention has drawn both criticism and praise from senators and public alike. Nova Imperium is outlawed for sedition due to its isolationist policies, and its leader is not recognised by the Imperial Family. However, a non-aggression pact was agreed between Aisling and Hadrian in 3305.

A defiant Aisling Duval told The Imperial Herald:

“I recently lost one member of my family to these extremists. I am not about to lose another. Regardless of politics, Hadrian is my cousin, and there are precious few Duvals left alive.”

Nova Imperium’s head of security, Praetor Leo Magnus, commented:

“I am confident that our Imperator would have survived, but we do appreciate Her Highness’s assistance. It remains a mystery how the NMLA could come so close to succeeding, but my investigations continue.”

Federation Accused of Supporting the NMLA
03 NOV 3306
The Empire has revealed new evidence that suggests the NMLA terrorist group may be receiving help from elements within the Federation.

A report from the Imperial Internal Security Service stated:

“With information provided by the engineer Liz Ryder, we located an abandoned workshop where explosives had been constructed using her blueprints. Traces were found of Thargoid caustic enzymes, matching the payloads delivered during the starport bombings.”

“Micro-signage on cargo containers identified bulk deliveries of equipment from a Federal system in neutral space, where we believe the NMLA has a second bomb-making facility. IISS agents are currently investigating to confirm these findings.”

Federal Ambassador Jordan Rochester refuted these allegations:

“The suggestion that we’re responsible for the Empire’s home-grown extremists is laughable. As with their persecution of Marlinists, this is another excuse for an inability to solve their own problems.”

Imperial Ambassador Imogen Luciana responded:

“There have long been rumours that the NMLA has the Federation’s support, to destabilise the Empire and promote republican propaganda. If true, there will be severe consequences.”

In related news, some Federal systems are struggling to cope with an influx of Marlinist refugees. Public disobedience, food shortages and epidemics have been reported in the Thetis, LTT 1935 and HIP 36081 systems, due to a lack of additional resources.

Federal and Imperial Forces Engage in Battle
05 NOV 3306
Pilots Federation ALERT

The Empire’s counter-terrorism operation in the LTT 1935 system has triggered armed resistance from the Federation.

The Imperial Internal Security Service’s investigation into the NMLA terrorist group led its agents to LTT 1935, a Federation-controlled system in neutral space. Military vessels were called in for support, only to be met in combat by Federal forces.

A declaration was made by Colonel Ernest Harris of the LTT 1935 Confederacy:

“The Empire cannot dominate and arrest our citizens as it did with the Marlinists. We claim the right to defend the Federation’s territory from such aggressive tactics.”

Captain Axel Cyprian of the L.Y.S Corp responded:

“The IISS has confirmed that the Neo-Marlinists have secret bomb-making factories concealed within LTT 1935. To prevent future atrocities, it is vital that we take control of this system and shut down the NMLA’s source of weapons.”

The LTT 1935 Confederacy has requested help from independent pilots to defend LTT 1935 from occupation by the Empire.

The L.Y.S Corp has also asked for auxiliaries to assist in gaining control of the system.

Terrorism Spreads as Superpower Conflicts Increase
06 NOV 3306
Neo-Marlinist extremists are continuing their campaign of terror, while the Empire and Federation clash over issues caused by Marlinist refugees.

The Imperial Herald has featured updates on terrorist activity across the Empire:

“The NMLA has claimed responsibility for over fifty bomb attacks during the last three weeks. These mostly targeted local authority buildings and security forces, killing hundreds. Hit squads have also assassinated several high-profile individuals connected to the Duvals, including the Emperor’s relative Baron Cesare Lavigny.”

“Senior IISS leaders have admitted to being unprepared for how organised and well-equipped the paramilitary group is. Critics suggest that the mass arrest of Marlinists may have radicalised many people who were already sympathetic to the republican ideology.”

The Federal Times has focused on the tensions between superpowers:

“With diplomatic channels closing down, the possibility that the confrontation in LTT 1935 might escalate into all-out war cannot be ignored. There is added pressure from the exodus of millions of Marlinists, whose beliefs align with the Federation’s democratic principles.”

“President Hudson is still suffering from reduced congressional support, and many have said that it feels like Felicia Winters is running the show. But although her humanitarian efforts undoubtedly saved many refugees’ lives, the acceptance of Imperial outcasts into Federal society remains in question.”

‘Ghost Ship’ Leads Alliance to New Resources
09 NOV 3306
Discoveries made two hundred years ago by an abandoned megaship have revealed untapped sources of meta-alloys within the Coalsack Nebula.

The Adamastor, which was launched in 3111, returned to the Chukchan system from the Coalsack Nebula on autopilot with no traces of its crew. Thargoid barnacle sites were found in the nebula by independent pilots.

The Alliance Assembly has announced an expedition to thoroughly explore the nebula, with the primary goal of securing fresh sources of meta-alloys. A press release stated:

“Recent Thargoid activity in the Witch Head Nebula and over-exploitation of that region mean that this latest discovery has come at an opportune time. The Coalsack Nebula will now be the focus of an initiative to identify sites of commercial and scientific interest. To achieve this, we have established new partnerships with several corporations including Sirius Atmospherics.”

“Although the mystery of the Adamastor may never be fully resolved, we hope it will leave a positive legacy for the people of the Alliance.”

Mention of corporate partnerships caused ripples in certain industries, with speculation that these have been in the pipeline for months. Political commentators also observed that 3307 will be an election year for the Alliance, placing pressure on Prime Minister Edmund Mahon to secure economic stability.

Hadrian Duval Seeks Reintegration with the Empire
10 NOV 3306
Imperator Hadrian Augustus Duval has recovered from an assassination attempt and signalled a new direction for Nova Imperium.

Princess Aisling Duval provided advanced medical care for Imperator Duval after a near-fatal attack by NMLA assassins. Following a period of discussion, she told the media:

“At this time of crisis we need allies more than ever, and my cousin’s royal heritage should not be denied. I have therefore formally requested sovereign consent for him to be accepted into the Imperial Family as Prince Hadrian.”

Hadrian Duval broadcast this message from Dyson City:

“I owe my life to Aisling, but life without purpose means nothing, and the Duvals’ purpose has always been to protect the Empire. I seek to adopt my birthright and help defend our traditional ways of life.”

“However, many of us see disturbing parallels between the brutal purge of Nova Imperium’s followers in 3305 and the current crusade against the Marlinists. I call upon those in power not to repeat this mistake – the NMLA is the common enemy we must unite against.”

Many senators publicly agreed that the Empire must heal past divisions to focus on the Neo-Marlinist threat. Others have voiced concerns at the repercussions of Emperor Hengist’s illegitimate grandson becoming an heir to the throne. As yet, Emperor Arissa Lavigny-Duval has not responded.

Federal System Resists Imperial Takeover
12 NOV 3306
Pilots Federation ALERT

The Federation has successfully maintained control of the LTT 1935 system, following a battle against local Imperial forces. The conflict was caused by an Imperial investigation that traced deliveries of bomb-making materials from this system to an NMLA workshop.

Colonel Ernest Harris of the LTT 1935 Confederacy stated:

“The LTT 1935 system remains part of the Federation, now that we have defended against the Empire’s attempt to take control. Our citizens have been saved from the indignities of Imperial interrogation.”

“In gratitude to the Federal auxiliaries and independent pilots who helped support our freedom, rewards are now available at Wolf Port .”

There was also a message from Captain Axel Cyprian of the L.Y.S Corp:

“This is a serious setback in our war against the NMLA terrorists, who the Federation seem eager to protect. Nevertheless, for all those courageous pilots who flew on our behalf, we can offer generous payments from Strength of Purpose.”

Alliance Launches Coalsack Nebula Campaign
12 NOV 3306
Pilots Federation ALERT

Commodities and anti-xeno support are requested as the Alliance begins exploitation of the Coalsack Nebula.

The Alliance plans to construct several new outposts in the Coalsack Nebula. From these, commercial and scientific operations will be conducted to locate fresh sources of meta-alloys and other potential sites of interest.

The initiative was prompted by the findings of a planetary survey team two hundred years ago, which were only discovered after an abandoned megaship arrived in the Chukchan system.

Shipments of power generators, robotics, structural regulators and building fabricators are required, and can be delivered to the megaship Spirit of Nysa in the Musca Dark Region PJ-P b6-1 system. The more commodities that are supplied, the more outposts will be upgraded to starports and the greater the range of services they will offer.

Commodore Morag Halloran of the Alliance Defence Force discussed security arrangements:

“We anticipate a heavy Thargoid presence within the Coalsack Nebula. Therefore it is a strategic necessity that we act now to curtail the threat to future exploration.”

“Independent pilots and anti-xeno squadrons can serve the Alliance by focusing their efforts on the Coalsack Sector KN-S b4-9, Coalsack Sector VU-O b6-6, Musca Dark Region IM-V c2-24 and Musca Dark Region PJ-P b6-1 systems, which will host the new structures.”

Emperor Decides Hadrian Duval’s Status
16 NOV 3306
Princess Aisling Duval’s request for her cousin, Imperator Hadrian Augustus Duval, to be accepted into the Imperial Family has been denied.

Emperor Arissa Lavigny-Duval’s decision was delivered to the Senate by Chancellor Anders Blaine:

“Her Majesty acknowledges that Hadrian is a Duval by blood, and offers royal pardons to him and his followers for previous crimes against the Empire. However, she does not bestow upon him the title of prince, nor offer any formal position within the Imperial Family.”

Aisling Duval and Hadrian Duval both expressed disappointment, but agreed to accept the decree. The Senate has now ratified the Treaty of Paresa, which removes Nova Imperium’s outlaw status in return for accepting Emperor Arissa’s rule and contributing to operations against the NMLA.

The Imperial Herald’s political journalist Cassia Carvalho commented:

“This surprisingly even-handed judgement is widely seen as bowing to pressure from the Senate, where there is much loyalty to Aisling Duval. Some interpret it as atonement – or regaining political goodwill – for the purge of Nova Imperium in 3305, which included the execution of several senators.”

“The image this projects is of an Empire coming together against the greater threat posed by Neo-Marlinists. But there is speculation that an alliance between the two youngest Duvals may one day challenge the Emperor for the throne.”

Coalsack Nebula Campaign Completes Initial Stages
17 NOV 3306
Pilots Federation ALERT

An Alliance initiative has successfully prepared the Coalsack Nebula for exploitation and reduced the Thargoids’ presence.

Traders delivered shipments of power generators, robotics, structural regulators and building fabricators, which will be used to help construct several new facilities in the region.

The quantity of commodities received will result in construction of the following for the 26th of November 3306:

Betancourt Base Starport in the Musca Dark Region PJ-P b6-1 system.

Additional services: Interstellar factor, human technology broker, encoded material trader, extended range of Multi-purpose ships.

Cole Point Starport in the CoalSack Sector VU-0 B6-6 system.

Additional services: Interstellar factor, raw material trader, extended range of Multi-purpose ships and mining equipment, fleet carrier administration.

Hannu Arena Starport in the Musca Dark Region IM-V C2-24 system.

Additional services: Interstellar factor, range of combat ships and weapons.

Bering Port Starport in the CoalSack Sector KN-S B4-9 system.

Additional services: Interstellar factor, improved outfitting options, manufactured material trader.

Commodore Morag Halloran of the Alliance Defence Force delivered an update on the security procedures:

“Our efforts to clear the systems of Thargoid vessels were hugely boosted by independent pilots. Their skills have enabled our transports to travel to the nebula in relative safety.”

The Alliance is collaborating with several corporations to investigate the Coalsack Nebula for commercial and scientific sites of interest.

Terrorists Identified Among Marlinist Refugees
18 NOV 3306
A screening process for Marlinist asylum-seekers arriving in the Federation has located several members of the NMLA terrorist group.

Vice President Brad Mitchell personally initiated a Federal Security Service operation to uncover any Neo-Marlinist extremists concealed among the refugee population.

The Vice President delivered this report to Congress:

“After standard ID scans flagged up some potential suspects, FSS officers employed more vigorous checks and interview techniques. They found nine individuals who were active members of the NMLA.”

“The terrorists have been transported to secure facilities for further interrogation, after which they will be handed over to Imperial authorities. Our security services remain vigilant against this danger that the Liberal Party has invited into our communities.”

Vox Galactica featured a statement by Marlinist community leader Dr Jenna Fairfax:

“I am horrified to learn of NMLA hiding among us. These killers do not represent the principles of Marlinism, and we are happy to cooperate in expelling them.”

In related news, protestors on several Federal worlds have warned of increased crime, terrorism and economic damage unless all refugees are sent back to the Empire. Counter-protests have called for the Marlinists to be welcomed as fellow believers in democratic government.

Terrorist Bombing at Federal Starport
19 NOV 3306
Pilots Federation ALERT

Multiple explosions have struck Kepler Orbital in the Atropos system, causing huge damage and loss of life.

Witnesses have observed signs of corrosion damage to the starport. This is characteristic of an explosive designed by the engineer Liz Ryder that deploys Thargoid caustic enzymes, and which was used in the bombings of Imperial starports in September.

The NMLA has claimed responsibility for the attack. Its propaganda channels praised “the nine martyrs”, a reference to the terrorist suspects recently arrested by the Federal Security Service. There were also warnings of “further reprisals if the Federation impedes our cause”.

The FSS has since confirmed that the captive NMLA members were being held in secure facilities at Kepler Orbital, which have been completely destroyed by the blasts. It is assumed that they were specifically targeted to prevent the prisoners revealing information about the paramilitary group under interrogation.

Federal authorities are urgently requesting support from the galactic community, to assist with repair efforts and to rescue survivors still trapped at the damaged station.

Superpowers React to Latest NMLA Strike
20 NOV 3306
Relations between the Empire and the Federation have deteriorated following a terror attack by Neo-Marlinists against a Federal starport.

Kepler Orbital in the Atropos system was bombed by the NMLA to eliminate several of its captured members, before they could reveal anything under interrogation by the Federal Security Service.

Imperial Ambassador Imogen Luciana made this statement:

“The NMLA was obviously able to make use of its bomb-making factories within the LTT 1935 system. If the Federation had not resisted our investigation, we would have shut these down and prevented the attack.”

“Our warning about the extremist threat went unheeded, and the Federation is now paying the price. We once again insist that all Marlinists are repatriated to the Empire.”

Ambassador Jordan Rochester has not responded, but did confirm that Federal embassies in several Imperial systems have closed after violent anti-Marlinist protests placed diplomatic staff’s lives at risk.

In Congress, Vice President Brad Mitchell directly blamed Shadow President Felicia Winters for the recent attack. He accused her of “laying out the welcome mat for terrorists” by offering sanctuary to the Marlinists. Other congressmen argued that she had prioritised aid for Imperial rather than Federal citizens.

There is evidence that Winters is now losing some of her recently gained political capital. However, the Liberal Party’s popularity remains high in the wake of President Hudson’s alleged association with the destruction of Starship One.

Commodity Prices Affected by Market Volatility
23 NOV 3306
Pilots Federation ALERT

Volatile trading markets have caused widespread price changes on several commodities, with a focus on the mining sector.

Alongside general market instability, unprecedented stock levels for a range of mined materials such as painite – once the gold standard of many systems – mean they now have uncertain futures.

Many financial experts predicted this correction to the markets, and saw it as an inevitable change. Others see this as a direct result of escalating tensions between the Empire and the Federation, with a few dismissing it as a minor anomaly and that prices will rapidly return to normal.

Professor Ophelia Kaufmann, head of economics at Orion Independent University, observed:

“There is certainly historical precedent for volatile markets during periods of political instability. Whatever the real cause or outlook in the short term, commodity values have become far more susceptible to market forces.”

“This is a notoriously difficult field in which to make predictions, but it is likely that prices for some lower-value goods may increase. The only certainty is of further fluctuations, but their severity will largely depend on how the precarious situation between superpowers is resolved.”

Core Dynamics Bids to Purchase Lakon Spaceways
24 NOV 3306
An official bid for complete ownership of Lakon Spaceways has been made by Core Dynamics, a major shipbuilding corporation in the Federation.

The announcement caused ripples in the manufacturing sector, particularly as Lakon has been in partnership with the Alliance for several years.

The newsfeed Sol Today featured a statement by Jupiter Rochester, the CEO of Core Dynamics:

“Lakon Spaceways has made a name for itself with its practical and well-respected ship designs – the workhorses of the galaxy. Core Dynamics can help the company reach greater heights, and be even more successful.”

“This can only be a positive move for both corporations. As with our acquisition of Vodel last year, Lakon will retain its talented engineers and production facilities while operating under our guidance.”

There has been no response yet from the board of directors at Lakon Spaceways. Some industry specialists have speculated that the company may have financial difficulties, after investing heavily in the Alliance Chieftain and its sister ships.

Questions have been raised in the Alliance Assembly about the legality of inter-superpower corporate mergers. However, neither the Federal Commerce Authority nor the Independent Commission for Market Equality have disapproved of the proposal.

Alliance Consolidates Presence in Coalsack Nebula
26 NOV 3306
Pilots Federation ALERT

The Alliance has opened new starports in the Coalsack Nebula, and is offering high prices for Thargoid-related commodities.

Following a successful campaign to establish a foothold in the nebula, the Alliance has announced that several new starports have become operational. These are:

Betancourt Base in the Musca Dark Region PJ-P b6-1 system.

Cole Point in the Coalsack Sector VU-0 B6-6 system.

Hannu Arena in the Musca Dark Region IM-V C2-24 system.

Bering Port in the Coalsack Sector KN-S B4-9 system.

The starports will serve as launchpads for further exploration of the region. Several corporations are working in partnership with the Alliance to locate commercial and scientific sites of interest.

One of the new research stations, Betancourt Base, has requested deliveries of Thargoid commodities. Chief xenobiologist Dr Rodion Stathos outlined the offer:

“The Thargoids have been in the Coalsack Nebula for at least two hundred years, giving us an opportunity to increase our understanding of this alien species. Thanks to funding provided by pharmaceutical and bioengineering companies, we can offer generous rewards for shipments of Thargoid biological matter and other artefacts.”

The Shadow of War
27 NOV 3306
NMLA terrorist attacks and the Marlinist refugee crisis have driven an increase in military spending from both the Empire and the Federation.

The Federal Times has reported on President Zachary Hudson’s actions:

“Building on the public outcry following the Neo-Marlinist bombing of a Federal starport, President Hudson has positioned himself once again as the Federation’s strongman. This is clearly a calculated effort to regain political power after negative associations from the Starship One trial.”

“Shadow President Felicia Winters’s acceptance of Marlinist refugees has lost popularity, now that terrorists concealed among them have murdered thousands. However, cooler heads in Congress agree that provoking the Empire could lead to a far greater death toll.”

The Empire’s response mirrored its counterpart, as observed by The Imperial Herald:

“As well as the construction of new capital ships, Senator Denton Patreus has also ordered the withdrawal of funding for Aegis. The Senate’s consensus is that since Thargoid activity has reduced, the focus should now be on the Federation as well as the internal threat of the NMLA.”

“Cooperation between the superpowers is rapidly coming to an end, leading to a state of interstellar brinkmanship. There is a real possibility that the Neo-Marlinists’ demand for revolutionary change may have broader repercussions than they intended.”

Bounty Voucher Boost to Increase Local Security
30 NOV 3306
Pilots Federation ALERT

Bounty hunters are advised that credit rewards for successfully destroyed targets have been increased.

With the widespread redirection of resources toward faction and superpower militaries, local security forces are struggling to provide effective intra-system policing. Coupled with a rise in piracy and violent crime, this has led to a need for supplementary ships and manpower in the majority of systems.

As a result, bounty vouchers for known criminals are now worth more in Alliance, Imperial, Federal and independent space. This increase will be honoured by all starport security offices, and other locations that offer Interstellar Factor services.

Bounty hunter groups and private law enforcement agencies are alerting their members to the changes. This message from the notorious Kazimir Clan is typical of the information being distributed:

“Don’t be surprised if you scan a wanted ship and it displays the same amount as it did before. Many security services haven’t updated their networks with the higher payouts – probably to make it look like they aren’t relying on us to do their dirty work. Once the claim is validated, the appropriate increase is applied and will be visible in your transactions panel.”

As with recent dramatic changes to the pricing of commodities, a period of volatility for bounties is expected as market forces define their true value in these uncertain times. As yet, the value of combat bonds has not been affected.

Lakon Spaceways Rejects Core Dynamics Bid
01 DEC 3306
A proposal by the Federal corporation Core Dynamics to purchase the construction company Lakon Spaceways has been officially rejected.

Naomi Landseer, chairperson of Lakon’s board of directors, made this statement:

“We thank Mr Rochester and his team for their approach. However, I can confirm that Lakon Spaceways will remain an independent company.”

Business reporter Irfan Karim analysed the situation more closely for The Alliance Tribune:

“This decision has surprised many analysts, considering the persistent rumours that Lakon is in far greater difficulty than financial statements would suggest. Although its shipbuilding partnership with the Alliance proved highly lucrative, insiders believe that the firm has overstretched itself in terms of resources and manpower.”

“There have also been public comments from high-profile shareholders in Lakon, who are pressuring the board to accept ownership by Core Dynamics. Some complain of falling dividends, while others accuse Ms Landseer of focusing exclusively on Alliance contracts.”

A spokesperson for Core Dynamics confirmed that the offer to purchase Lakon Spaceways has not yet been withdrawn, and that CEO Jupiter Rochester is looking at all available options.

Explorers Needed for Coalsack Nebula Project
03 DEC 3306
Pilots Federation ALERT

Sirius Atmospherics has requested help from independent pilots to provide exploration data focusing on ammonia worlds for terraforming purposes.

The subsidiary of Sirius Corporation is working in partnership with the Alliance to establish colonies within the Coalsack Nebula, and to identify sites of commercial and scientific interest.

Dr Maximilian North, Sirius Atmospherics’s project director, outlined the requirements:

“We have developed revolutionary new terraforming procedures for terrestrial planets with ammonia-based atmospheres. Our collaboration with the Alliance is the perfect opportunity to try and put these to practical use, with the goal of transforming the region into a more human-friendly place.”

“Sirius Atmospherics offers rewards for explorers who can provide us with exploration data. We are particularly interested in detailed scans focusing on the composition of ammonia worlds, not just in the Coalsack Nebula but elsewhere. Gathering wide-ranging data will enable us to determine the most suitable targets for environmental conversion.”

Pilots are requested to deliver exploration data to the Sirius Atmospherics research facility at Betancourt Base in the Musca Dark Region PJ-P b6-1 system.

Capital Ship Construction Initiatives Conclude
03 DEC 3306
Pilots Federation ALERT

Parallel campaigns in the Empire and the Federation to provide commodities for building new capital ships have ended.

The Federal Navy’s construction programme was boosted by deliveries of building fabricators, microbial furnaces and energy grid assemblies. Contributing pilots can now collect their rewards at Schweickart City in the Parutis system.

As a result, 5 newly completed Farragut-class Battle Cruisers will become operational within a matter of days. They are expected to be patrolling in several Federal systems including Atropos, Iman Caber, LHS 142, LFT 367 and Wolf 25.

The Imperial Navy is also rewarding all traders who delivered building fabricators, microbial furnaces and energy grid assemblies for use in its shipyards. Payments can be collected from Miyasaka Orbital in the Mandh system.

It has been confirmed that 4 new Majestic-class Interdictors will shortly join the fleet. Filed flight plans suggest that their shakedown cruises will take place in the Chimechilo, Orannika, Theta Indi and Zelano systems.

As well as capital ships, Federal Congress and the Imperial Senate have both increased funding for other military operations, including support vessels and ground forces.

Lakon Spaceways Discounts Selected Ships
07 DEC 3306
Pilots Federation ALERT

Temporary price reductions have been announced for several Lakon vessels, in an effort to increase short-term profits.

Lakon Spaceways has applied a 30% discount on sales of the following ship types:

Asp Scout

Diamondback Scout

Keelback

Type-7 Transporter

Type-10 Defender

The reduced prices are expected to last until the 30th of December 3306.

Some industry analysts believe this is an attempt to increase short-term payouts for Lakon’s shareholders, many of whom have complained about falling dividends. Other investors have publicly pressured the company to accept a takeover bid from the Federal corporation Core Dynamics.

These issues were addressed by Naomi Landseer, chairperson of Lakon’s board of directors:

“It is true that profit margins are not as impressive as in previous years, but we can assure all stakeholders and customers that Lakon Spaceways remains financially secure. We project an upswing in military contracts during this turbulent time, and our achievements on behalf of the Alliance position us as one of the galaxy’s premiere shipbuilders.”

Marlinist Refugee Crisis Grows Critical
08 DEC 3306
Hundreds of thousands of political refugees who fled from the Empire to the Federation have brought both superpowers to the brink of conflict.

The Marlinists, who believe in restructuring the Empire into a republic, escaped crackdowns in several Imperial systems during a hunt for Neo-Marlinist terrorists.

The Federation has provided temporary safe haven for the refugees. However, security concerns proved to be justified when the NMLA bombed a Federal starport where captured members were being held.

The Federal Security Service provided this update:

“The Marlinists themselves have informed us of more individuals among them with NMLA connections. The risk of terrorism from this population is now low, although it’s impossible to know exactly how many have been radicalised.”

There have been heated debates in Congress over granting citizenship to the Marlinists. President Hudson insisted that “all illegal aliens must be deported”, and has strengthened the Federal Navy as a defensive measure in light of the Empire’s warnings.

Conversely, Shadow President Winters argued that “turning away starving refugees to face imprisonment and discrimination would be immoral”. She also noted that the same principles of democratic representation found in Marlinism are enshrined in the Federal Accord.

This disagreement between the Republican and Liberal Parties has led to stalemate, with the fate of the Marlinists hanging in the balance.

Universal Increase to Combat Bond and Anti-Xeno Payouts
08 DEC 3306
Pilots Federation ALERT

The values of combat bonds and anti-xeno bonds have been increased, as factions focus on bolstering defences.

Financial instability and the current political tensions have led to factions upscaling their rewards for combat bonds, as well as bonds received for destroying Thargoid vessels.

These increases to anti-xeno and combat bonds will be in effect across Alliance, Federal, Imperial and independent space. They can be processed as usual at any starport offering the relevant services.

This follows a turbulent period in many marketplaces that has impacted commodity prices, as well as producing a boost to the value of bounty vouchers.

The changes were remarked upon by Professor Ophelia Kaufmann, head of economics at Orion Independent University:

“As anticipated, the ongoing volatility of financial markets has led to further widespread revaluation. With heightened hostility between the Empire and the Federation, coupled with terrorist attacks and a resurgence in Thargoid activity, it is hardly surprising that every faction now places a greater premium on protecting their citizens.”

“Although some may view the current tranche of changes as inevitable or overdue, there may well be additional revaluing in other fields as a result of competing market forces. The only certainty is of further uncertainty.”

Coalsack Nebula Project Gathers Ammonia Worlds Data
10 DEC 3306
Pilots Federation ALERT

Explorers have catalogued many ammonia worlds for a Sirius Atmospherics terraforming project in the Coalsack Nebula.

The subsidiary of Sirius Corporation is one of several companies that are working in partnership with the Alliance to commercially exploit the region.

Project director Dr Maximilian North announced the successful completion of the initiative:

“The data provided on planets with ammonia-based atmospheres will be invaluable to our terraforming simulations. With our new environmental techniques, some of these poisonous worlds within the nebula may one day become habitable.”

Sirius Atmospherics has confirmed that payouts for all contributing pilots are now available at Betancourt Base in the Musca Dark Region PJ-P b6-1 system.

As the expansion into the Coalsack Nebula progresses, Commodore Morag Halloran of the Alliance Defence Force commented on the possibility of further attacks from the Thargoids:

“Anti-xeno security is not as stringent as we had planned, due to the low availability of ADF vessels and Aegis being impacted by Federal and Imperial defunding. It may be necessary to call upon the galactic community again, should we encounter further interference from the Thargoids.”

Sirius Corporation Campaign to Establish Marlinist Colonies
10 DEC 3306
Pilots Federation ALERT

Commodities are requested to create new settlements for Marlinist refugees who fled from the Empire to the Federation.

Sirius Corporation has offered to resolve the current standoff between superpowers by establishing colonies where the refugees can live independently.

Li Yong-Rui, CEO of Sirius Corporation, summarised his proposal:

“It is clear that the Marlinists cannot return to the Empire, and are a destabilising presence within the Federation. We offer an alternative by constructing permanent habitats for their population. These will be self-governed and may freely trade with the galactic community.”

“Sirius cannot stand by while the risk of interstellar war increases. I sincerely hope this leads to a more stable and profitable period for us all.”

After intense debate, both Congress and the Senate accepted the proposal, with the proviso that any refugees identified as NMLA members will be returned to the Empire.

Dr Jenna Fairfax, a Marlinist community leader, also offered her approval:

“We were forced to abandon our entire lives because of our political beliefs. This at least gives us a chance to have homes again.”

Traders are asked to deliver atmospheric processors, auto-fabricators, structural regulators and water purifiers to Ellis Gateway in the Bd+05 1146 system. From there, the Omega Merchant Command will distribute resources for the colonisation of up to ten uninhabited systems.
 
Last edited:
Reserved for future content
Multi-billionaire Zachary Rackham is constructing a permanent outpost at the farthest system above the galactic plane.

The orbital outpost will be located within the HIP 58832 system. This is commonly held to be at the galactic zenith, one of the highest locations that can practically be reached.

The project is funded by the corporation Rackham Capital Investments, with the close involvement of Universal Cartographics and several other scientific organisations. The outpost’s location will make it ideal for gathering astronomical data on the overall structure of the galactic spiral.

This historic scientific endeavour was remarked upon by Mr Rackham from his private villa complex on the Rhea Archipelago:

“Back in my days of plying the trade routes in a second-hand Sidewinder, the idea of standing on the roof of space was an idle daydream. This new generation of pilots and ships will make my vision a reality.”

“No doubt many important scientific observations will be made once the outpost is up and running, but more importantly, there’ll be a bar – and the drinks are on me!”

A spokesperson for Rackham Capital Investments later confirmed that the outpost in the HIP 58832 system would be operational on the 17th of December 3306, but clarified that there was no legal guarantee for beverage reimbursement.

Pilots Federation ALERT

Prices for several Core Dynamics vessels have been temporarily reduced, as part of an attempt to purchase Lakon Spaceways.

The shipbuilding corporation has applied a 30% discount to sales of the Eagle Mk II and the Vulture. There is also a 20% discount on sales of Federal Assault Ships, Federal Dropships and Federal Gunships, although the Federal Navy rank requirements for each vessel continue to apply.

The reduced prices are expected to last until the 30th of December 3306.

Core Dynamics recently made a proposal to acquire rival company Lakon Spaceways, which rejected the offer then applied markdowns to its own ships to increase short-term profits.

The Alliance Tribune’s business reporter Irfan Karim speculated on these developments:

“CEO Jupiter Rochester remains tight-lipped on the reasons for these discounts, but it seems likely that he is raising funds for a more aggressive bid. Rumours are circulating of Lakon investors being bribed to sell their shares, or coerced into demanding that the board of directors accepts ownership by Core Dynamics.”

“Many industry analysts are convinced that a hostile takeover of Lakon Spaceways is underway. If successful, we could see vessels that are commonly associated with the Alliance – such as the Chieftain and Type-10 Defender – manufactured by a Federal corporation in the future.”

*
Pilots Federation ALERT*

Multi-billionaire Zachary Rackham’s new orbital outpost at the galactic zenith is now operational.

Rackham’s Peak is situated in the HIP 58832 system, one of the highest practical locations above the galactic plane. Its construction was funded by Rackham Capital Investments, in conjunction with Universal Cartographics and other scientific research companies.

Traders have been welcomed, although the increased distances between stars at the galaxy’s fringes mean that vessels with a high jump range are recommended. Rackham’s Peak is currently offering high prices for deliveries of beer, liquor, wine, Bast Snake Gin, Centauri Mega Gin, Chateau De Aegaeon, Eranin Pearl Whisky, Gerasian Gueuze Beer, Harma Silver Sea Rum, Indi Bourbon, Kongga Ale, Lavian Brandy, Leestian Evil Juice, Saxon Wine, Thrutis Cream and Wuthielo Ku Froth.

Mr Rackham officiated at the outpost’s opening ceremony, which was followed by an extravagant press party for media representatives and attending celebrities. He gave this statement:

“The top of the galaxy is now open for business! Rackham’s Peak is a free port where everyone is welcome, a place where explorers and entrepreneurs can enjoy drinks while overlooking the entire Milky Way. Aim high, Commanders!”

In related news, Rackham Capital Investments has agreed to pay a repairs bill from Universal Cartographics for the outpost’s sensor array control systems, which suffered fluid-related damage during the party.

Pilots Federation ALERT

Sirius Corporation has successfully gathered materials to construct new independent settlements for Marlinist emigrants.

Both the Empire and the Federation accepted the proposal from Sirius Corporation to establish colonies for the political refugees, who have been the cause of increased tension between the superpowers.

CEO Li Yong-Rui made this announcement:

“As always, the galactic community’s immense contribution has made this achievement possible. The shipments of atmospheric processors, auto-fabricators, structural regulators and water purifiers will be used to construct new outposts and settlements in 8 uninhabited systems.”

The Omega Merchant Command is now offering rewards at Ellis Gateway in the Bd+05 1146 system to all pilots who delivered commodities.

Aaron Whyte, a community leader among the refugees, commented on Vox Galactica:

“I suppose we should be grateful that these colonies give us a chance of survival. But none of us wanted to set up our own kingdoms – only to remove the kings. And one day, we will.”

The Marlinist population is expected to be transferred from Federal space to the new colonies in early 3307.

Pilots Federation ALERT

The effectiveness of engineers’ upgrading for ship modules will be boosted until the 7th of January 3307.

During this time, engineered weapons and modules will receive increased augmentation for the same amount of materials. This will apply to every workshop in Alliance, Imperial, Federal and independent space.

Lori Jameson, an engineer based in the Shinrarta Dezhra system, provided details to Vox Galactica on how this collaboration came about:

“After the Eurybia incident, some of us contacted Liz Ryder and offered our support. It was horrifying how her expertise had been abused by the NMLA, leaving her unfairly maligned as a terrorist supporter. There were concerns that her situation might reflect badly on engineers in general.”

“We soon established communication links between every workshop, and agreed to offer a universal boost to upgrades. Hopefully this will remind pilots how much we value their custom, and that we remain a trustworthy resource.”

Mel Brandon, one of four engineers in the Colonia Region, commented:

“It’s about time that we all started talking to each other. Our services are valuable to the whole galaxy. We deserve better protection. Maybe we have to start protecting ourselves.”

As independent colonies are set up for Marlinist refugees, there has been a lull in terrorist strikes from the Neo-Marlinist Liberation Army (NMLA).

In recent months, the paramilitary group launched multiple attacks across the Empire. Starports and administrative buildings were bombed and dozens of individuals assassinated, including Prince Harold and more distant members of the Duval family.

However, the number of incidents has fallen drastically following successful operations by the Imperial Internal Security Service:

“After the Federal Security Service identified NMLA members aboard the emigrants’ megaships, these were transferred to us for interrogation. We obtained information that enabled us to shut down many terrorist cells, although there is evidence that the NMLA’s network remains widespread.”

In related news, hundreds of thousands of Marlinist refugees are preparing to occupy new colony systems established by the Sirius Corporation. Mass transportation will take place early next year, overseen by Safeguard Interstellar. The Empire, Federation and Sirius Gov have all agreed that the settlements will remain fully independent.

The refugee population has already begun to determine its future social structure, based on the principles of Marlinism. A transitional parliament has been formed by community leaders such as Dr Jenna Fairfax, Aaron Whyte and Amrita Ross. Democratic elections for a representative government will take place once the Marlinist Colonies are operational.

A coalition of Lakon Spaceways shareholders has voted to replace several members of the company’s board of directors with new management.

At an emergency general meeting, investors put forward a resolution to remove selected directors, in accordance with Lakon’s articles of association. The majority vote was in favour of this resolution.

New appointees to the board have already stated that the rejected bid by Federal shipbuilder Core Dynamics will be reappraised. Jupiter Rochester, the corporation’s CEO, has welcomed the opportunity for fresh discussions.

Chairperson Naomi Landseer, who is one of the directors being replaced, told Vox Galactica:

“It’s no coincidence that the board members being voted out are the same ones who were against Core Dynamics owning the company. I am convinced that Rochester’s people are bribing or threatening our shareholders to make sure this hostile takeover goes through.”

Lakon Spaceways is currently offering a 30% discount on sales of Asp Scouts, Diamondback Scouts, Keelbacks, Type-7 Transporters and Type-10 Defenders.

Core Dynamics has applied a 30% markdown to sales of the Eagle MkII and the Vulture, with a 20% discount for Federal Assault Ships, Federal Dropships and Federal Gunships.

Tens of thousands of Marlinist refugees have claimed sanctuary in Alliance space, after emigrating from the Empire to avoid political persecution.

In recent weeks, there has been a steady stream of ex-Imperial citizens arriving at Alliance systems, mostly travelling aboard small private vessels or in the holds of cargo ships.

The humanitarian aid organisation Safeguard Interstellar reported that accommodation and basic necessities are being provided. Alliance Interpol is running stringent security checks for evidence that members of the NMLA terrorist group are present.

The initial wave of refugees, which fled to the Federation, are currently preparing to populate a number of independent colonies established by the Sirius Corporation. However, these systems cannot yet provide harbour to the continuing exodus of Marlinists from the Empire.

Prime Minister Edmund Mahon publicly welcomed the refugees, but there has been some dissent in the Alliance Assembly. Councillor Nakato Kaine, who is expected to be Mahon’s main rival in next year’s election, received widespread support for her views:

“Naturally, we must provide these poor people with emergency aid, but there are practical limits to our resources. It is not our responsibility to solve the Empire’s domestic issues, and we have seen the Federation pay the price for sheltering terrorists. The Alliance cannot end up as the dumping ground for other superpowers’ problems.”

Sirius Atmospherics has delivered an update on its experiments to terraform ammonia worlds in the Coalsack Nebula.

The subsidiary of Sirius Corporation is working closely with the Alliance to exploit the nebula’s resources and pursue scientific investigation, including terraforming terrestrial planets with ammonia-based atmospheres.

Project director Dr Maximilian North gave this progress report:

“Preliminary efforts at ecosphere conversion have delivered promising results, but our new techniques are not as effective as the simulations based on exploration data suggested. We are still a long way from fully transforming these worlds into habitable environments.”

Independent journalist Flint ‘Firemaker’ Lafosse commented on this via the Rewired network:

“Does anyone really believe Sirius is there for the terraforming? Of course they can’t magically turn ammonia hellholes into paradise planets overnight! I know a cover story when I smell one. I wouldn’t be surprised if they’re deliberately trying to provoke the Thargoids for some reason, maybe to capture some specimens. Where there’s xenos, there’s credits.”

The Alliance has corroborated Dr North’s report, but also confirmed an increase in Sirius Corporation personnel and equipment arriving in the Coalsack Nebula.

Economic instability has caused the value of shares in Lakon Spaceways to drop to unprecedented lows, placing the company’s future in doubt.

A hostile takeover bid by Federal corporation Core Dynamics has raised concerns in the Alliance over the loss of a major defence contractor. The Independent Commission for Market Equality has also reported irregularities in the recent transfer of share ownership, which may lead to criminal investigations.

As a result, although Lakon Spaceways continues to manufacture and sell ships, its lack of reserves and a loss of confidence among investors may lead to insolvency and dissolution.

Trent Delaney, the newly appointed chairperson of Lakon’s board of directors, announced:

“Financial mismanagement and a litany of poor business decisions have led to this situation. Rest assured that once formal negotiations with our new parent company are complete, Lakon’s stock will rise to new heights.”

According to Federal business analysts, there are indications of displeasure among Core Dynamics senior directors regarding this takeover. An anonymous source from within the corporation told Vox Galactica:

“The Lakon merger is entirely Jupiter Rochester’s project. Frankly, it’s sheer greed. Our income has soared recently with new commissions from the Navy, but Rochester’s grabbing hands are always reaching for something. He runs the departments that are loyal to him like they’re his personal kingdom.”

Pilots Federation ALERT

Large numbers of Thargoid vessels are swarming through multiple inhabited systems, leading to urgent calls for assistance.

In what appears to be a coordinated strike, Thargoid scouts and interceptors have appeared throughout the Coalsack and Witch Head Nebulas. Local security ships have engaged them in combat, but report being overwhelmed.

The Alliance has a considerable presence in these regions, with four starports recently constructed in the Coalsack Nebula. But the Alliance Defence Force has not been able to mobilise in time to prevent some systems from becoming infested with Thargoids.

Admiral Aden Tanner, chief military liaison for Aegis, made this announcement:

“This is a resurgence of Thargoid activity on a scale that we have not witnessed for a long time. Unfortunately, drastic reductions in funding and resources mean that Aegis is unable to provide adequate defensive measures.”

“We urgently request support from independent pilots and anti-xeno squadrons. It is critical that we prevent the Thargoids from dominating these nebulas and wiping out many thousands of people.”

Simguru Pranav Antal, leader of the Utopia commune, has proposed hosting a diplomatic conference for the governments of all three superpowers.

The intention is to provide a neutral location to discuss key issues such as the renewed Thargoid attacks, the Marlinist refugee crisis, and hostilities between the Empire and the Federation.

Details have been sent to the Alliance Assembly, Federal Congress and Imperial Senate. Pranav Antal has also broadcast his invitation across all media channels:

“It is not Utopia’s tradition to become involved with politics, but recent events are of great concern to us all. Interstellar war, terrorism, alien incursion and economic collapse are the new four dark horsemen that threaten humanity’s future.”

“We therefore offer to host a Galactic Summit where the Alliance, Empire and Federation may debate these problems peacefully. My sincere hope is that the heads of state grasp this opportunity to resolve their differences and create solutions that benefit their peoples.”

Utopia is an independent society with a focus on using highly advanced technology to increase quality of life. Should this Galactic Summit take place, it would be the first diplomatic meeting of all three superpower governments.

The Alliance has entered a period of political campaigning prior to the election of a new prime minister.

The appointment of a head of government takes place every six years, with the forthcoming vote scheduled for the 25th of February 3307.

Unlike the Federation, there are no political parties in the Alliance. The Assembly is comprised of councillors who each represent the ruling faction of a member system. Electoral votes will be cast by these individuals rather than the public, but councillors tend to abide by the majority views of their constituencies.

Edmund Mahon is the current prime minister, having been in office since 3301, and is campaigning for re-election. If successful, he will be the first to serve more than one term.

There are several rivals challenging Mahon, but the greatest support is for Councillor Nakato Kaine of Tionisla. She has become a rallying point for discontent among the Assembly, speaking out against the Alliance’s increasing dependence upon corporations and other superpowers.

At an emergency debate regarding the current wave of Thargoid attacks, Councillor Kaine stated:

“Can we be surprised that the Thargoid race is launching fresh assaults against us, when we brazenly invade their territories? Our obsession with meta-alloys has turned us into the aggressor! This is not the same Alliance that I pledged to serve. It’s time for a new direction.”

The shipbuilding company Lakon Spaceways has officially accepted a bid for ownership from Federal corporation Core Dynamics.

The proposal from Core Dynamics CEO Jupiter Rochester was ratified following a majority vote by Lakon’s board of directors, many of whom were recently appointed following resignations demanded by shareholders.

Trent Delaney, the new chairperson, confirmed the merger in a public statement:

“We are overjoyed that Lakon Spaceways will join the Core Dynamics family, thereby overturning the mistakes of the previous management and setting us on course for a bright future.”

“The transfer of ownership will take another two months to formalise. In that time, it will be business as usual for the manufacture and sale of our ships.”

The Federal Commerce Authority has approved the corporate takeover. However, the Independent Commission for Market Equality is still investigating reports of irregularities.

The Council of Admirals has expressed concerns that a military supplier for the Alliance Defence Force should be owned by a Federal defence contractor. Admiral Rachel Ziegler informed the Assembly:

“Regardless of our cordial relationship with the Federation, security issues will inevitably arise if the Alliance Chieftain and her sister ships are constructed by a foreign power. The ADF is already woefully underfunded, and this places extra strain on our ability to defend our interests.”

Pilots Federation ALERT

The Holloway Bioscience Institute in Colonia is offering high payouts for delivering samples from space-dwelling lifeforms.

The Holloway Biology Centre on Colonia 7 G is the organisation’s primary research laboratory, which specialises in xenological studies. Jaques Station, which is also in the Colonia system, has agreed to serve as the delivery point for this initiative.

Chief researcher Dr Roy Casimir outlined the requirements:

“There is still a huge amount to learn about the fascinating structures that grow within the vacuum of space. As our stock of specimens is running low, we require fresh tissue samples from living organisms to continue our experimentation programme.”

“I appreciate that our facility is located a considerable distance from the core systems, but we’re willing to offer generous reimbursement for those who make the journey.”

Pilots are requested to extract any type of tissue sample, including pod mesoglea, from any type of seed pod. These are to be delivered to Jaques Station in the Colonia system.

Starports in the Coalsack and Witch Head Nebulas have been damaged during full-scale Thargoid incursions.

An appeal by Aegis for anti-xeno support led to a concerted response from the galactic community. However, the Thargoid forces proved to be overwhelming and have attacked systems within the nebulas, with the loss of thousands of lives.

Admiral Aden Tanner, chief military liaison of Aegis, broadcast this message:

“Despite the heroic efforts of many pilots, the alien ships have resisted being driven from the Witch Head Nebula.”

“Aegis’s military capability and manpower are both severely limited as a result of curtailed funding from the Empire and the Federation. We have no choice but to rely on independent pilots and anti-xeno squadrons as the first line of defence against the Thargoid threat.”

The organisation Aegis has expressed support for Utopia’s offer to host a Galactic Summit for all three superpowers.

Aegis was jointly formed by the Alliance, Empire and Federation to study the Thargoids, and develop new methods of monitoring and combating their forces.

Professor Alba Tesreau, head of research at Aegis, gave this statement:

“Humanity’s focus on petty internal conflicts has blinded us to the existential threat of the Thargoids. Their recent horrific attacks should be a wake-up call to the fact that defunding has crippled Aegis’s ability to offer protection.”

“We strongly entreat our founders to come together and channel resources toward Aegis, and particularly into research. There can be no hope of coexistence with this alien species unless we increase our understanding of them.”

No official responses to Utopia’s proposal have been made as yet. However, Prime Minister Edmund Mahon, Princess Aisling Duval and Shadow President Felicia Winters have all signalled broad approval of the idea. There are reports that many congressmen, councillors and senators are pressuring their respective leaders to attend the diplomatic conference.

Simguru Pranav Antal has confirmed that the governments of independent systems will also be welcome to send delegates to the Galactic Summit. However, Utopia’s primary aim is to provide neutral territory for the Alliance, Empire and Federation to debate policies.

Fleet Admiral Lucas Vincent of the Federal Navy will stand trial on the 25th of January, charged with conspiracy to commit murder and treason.

The Federal Attorney’s Office has successfully obtained a grand jury indictment against Fleet Admiral Vincent. He is accused of arranging the sabotage of presidential vessel Starship One in 3301, to assassinate then-President Jasmina Halsey. Although she was later recovered alive, hundreds died when the ship was destroyed in flight.

These charges were brought following the trial of Rory Webster, a naval technician who was implicated in the failure of Starship One’s hyperdrive system. Mr Webster confessed his involvement, but offered a plea bargain by providing evidence that he was following clandestine orders from Vincent.

The subsequent arrest caused repercussions in military and political circles. President Zachary Hudson’s long-term association with Vincent resulted in Republican congressmen losing confidence in his leadership, and increased the Liberal Party’s popularity.

As a naval chief of staff, Fleet Admiral Vincent is the highest ranking Federal military officer to ever stand trial. Media interest remains intense, with much public speculation about corruption among the Federation’s highest echelons.

The trial will take place at the Federal High Court in Olympus Village on Mars, and is expected to last several weeks.

An anonymous source within the shipbuilding corporation Core Dynamics has revealed details behind its hostile takeover of Lakon Spaceways.

The nameless insider had previously stated that the acquisition of Lakon was the personal project of Core Dynamics CEO Jupiter Rochester. These additional claims were broadcast via Vox Galactica:

“In the last few years, Rochester has purchased many companies based outside the Federation, such as Vodel. Lakon Spaceways is just the latest. It seems legal, but he manages these subsidiaries directly and installs his own people there. Some say he’s diversifying his family’s private holdings, rather than expanding the business.”

“It’s well known that several departments only follow Rochester’s directives, and operate in silos unconnected with the rest of Core Dynamics. Staff refer to them as ‘Jupiter Division’. Some offices even started using that name, like they’re a separate company within a company.”

“I’ve heard that some directors are unhappy with Rochester, but he’s too well-connected to ever get rid of. It’s thanks to him that we have so many military contracts. As always, the rich get away with anything.”

Core Dynamics declined to comment on this statement. Naomi Landseer, former chairperson of the Lakon Spaceways board of directors, has asked the Independent Commission for Market Equality to investigate further.

Pilots Federation ALERT

The newly settled Marlinist Colonies have asked for urgent deliveries of foodstuffs.

Millions of Marlinists have relocated to eight systems colonised for them by the Sirius Corporation, thereby reducing tension between the Empire and the Federation. They have asked Universal Cartographics to delay a census of the systems’ populations, while the refugees lay the infrastructure for their new societies.

The Marlinist factions are holding democratic elections to select their leaders. However, the transitional parliament has declared an emergency due to the shortage of food stocks.

Community spokesperson Dr Jenna Fairfax announced:

“We are grateful to the galactic community and Sirius Corporation for providing homes. However, we need further help to feed our people in the short term, until we can become self-sufficient.”

“The more supplies we can stockpile, the faster our economies will develop. This in turn will allow us to offer greater commodity discounts, to encourage the establishment of regular trade routes.”

Pilots are asked to deliver animal meat, fish, fruit and vegetables, and grain to Stillman Hub in the HIP 22550 system.

As this system’s defence forces are still being formed, the Free Marlinists of Carinae have offered bounties on all wanted ships to secure these initial trade runs to the Marlinist Colonies.

Pilots Federation ALERT

The Holloway Bioscience Institute has rewarded pilots who delivered living matter extracted from space-dwelling organisms.

Many shipments of seed pod tissue samples arrived at Jaques Station, from where they will be transported to the Holloway Biology Centre on Colonia 7 G. These will be used to replenish stocks used in the facility’s experimentation programme.

Dr Roy Casimir, chief researcher at the centre, expressed his gratitude:

“These vital supplies mean that we can resume our studies on the incredible organisms that float through the void. Here at Holloway we’re making many breakthroughs in the field of xenobiology, some with intriguing commercial possibilities.”

The Holloway Bioscience Institute now plans to establish experimental habitats for vacuum lifeforms in the following systems:

Eol Prou PC-K c9-221

Eol Prou LW-L c8-99

Eol Prou KW-L c8-301

Eol Prou PC-K c9-154

Pilots who contributed to this initiative can now collect their rewards from Jacques Station in the Colonia system.

The purchase of shipbuilding company Lakon Spaceways by Core Dynamics is in doubt after allegations of illegal business practices.

Irfan Karim reported on the recent developments for The Alliance Tribune:

“The Independent Commission for Market Equality has confirmed that several Lakon shareholders sold their stock to shell companies, which were covertly established by departments within Core Dynamics. Furthermore, two serious accusations of blackmail have been referred to Alliance Interpol.”

“Trent Delaney, Lakon’s newly installed chairperson, has dismissed these claims. But coupled with serious rumblings from the Council of Admirals over losing a military supplier, this hostile takeover now looks less certain.”

In the Federation, the newsfeed Sol Today ran an editorial piece on the situation:

“Acquiring Lakon is another bold triumph for manufacturing colossus Core Dynamics. It’s a shame that it’s being undermined by the petty bureaucrats of the Alliance, who should be gratefully grasping this financial lifeline.”

“It’s also laughable that CEO Jupiter Rochester, one of our titans of industry, is being stabbed in the back by old-fashioned colleagues who are clearly jealous of his success. Perhaps his ‘Jupiter Division’ has finally outgrown the corporation and deserves to forge its own path.”


Utopia’s ability to host a diplomatic conference for all three superpowers has been challenged by the Sirius Corporation.

The megacorp’s counter-proposal was announced by CEO Li Yong-Rui:

“With all due respect to Simguru Antal, his commune cannot match our level of resources. Sirius is far better placed in terms of logistics and security, and our navy will be able to ensure the safe transportation of all delegates.”

“Furthermore, we already have excellent commercial relationships with the Alliance, Empire and Federation, and can therefore guarantee neutrality. Our recent philanthropic gesture at creating the Marlinist Colonies proves that we are an impartial, stabilising force for the whole galaxy.”

Discussions regarding the conference have been ongoing in superpower and independent systems alike. Some leaders have decried it as a pointless exercise, while others view it as a rare opportunity for political cohesion.

Sirius Corporation and Utopia’s propositions for a Galactic Summit are now being compared by potential attendees. However, Zachary Rackham’s offer to host the conference at the actual galactic summit of Rackham’s Peak is not being seriously considered.

Edmund Mahon has launched a political campaign to be elected as the Alliance’s leader for a second term.

The incumbent Prime Minister is undertaking a whistle-stop tour across Alliance space to rouse support. Only members of the Assembly can cast votes in this election, but they will be heavily influenced by public opinion within their systems.

Mahon’s campaign has focused on the Alliance’s huge expansion during his six-year premiership, with reminders of triumphs such as the Alliance Festival of Culture. His ability to handle a crisis has also been highlighted, including President Kincaid’s attempted coup and the League of Reparation’s crusade.

More recent examples of his leadership are welcoming Marlinist refugees from the Empire and exploiting the Coalsack Nebula to boost economic prosperity. However, Mahon’s critics have pointed out that both strategies increased the risk of attack from Neo-Marlinist terrorists and the Thargoids.

Addressing a packed conference hall on Birmingham in his home system of Diso, Mahon proclaimed:

“We live in an increasingly turbulent galaxy, making it important to maintain a steady hand at the wheel. I will be honoured to continue representing the diverse peoples of the Alliance.”

Former President Jasmina Halsey has arrived on Mars to stand as a witness in the upcoming trial of Fleet Admiral Lucas Vincent.

Halsey was subpoenaed by the Federal High Court to testify before the jury. Although this was not legally enforceable, since she now lives beyond the Federation’s jurisdiction, she has acceded to the court’s request.

Jasmina Halsey served as Federal president prior to the destruction of Starship One in 3301, which Vincent is accused of arranging. She was recovered alive, but abandoned her political career and emigrated to the Alliance. She has since campaigned as a peace activist and acted as an adviser to Prime Minister Edmund Mahon.

After greeting a large crowd of supporters at Olympus Village Spaceport, Halsey gave a statement to The Federal Times:

“This is a bittersweet moment for me. Coming back to the Federation feels like revisiting a past life. But perhaps we can finally lay some ghosts to rest.”

She was welcomed in person by Shadow President Felicia Winters, who was secretary of state in Halsey’s administration. However, President Zachary Hudson has made no comment regarding his predecessor’s return or the forthcoming trial of Fleet Admiral Vincent.

Pilots Federation ALERT

Large amounts of food commodities have been delivered to the Marlinist Colonies.

Multiple shipments of animal meat, fish, fruit and vegetables, and grain were transported to Stillman Hub. Messages of gratitude were broadcast from all the Marlinist factions, which have distributed these vital supplies across the eight colony systems.

The Free Marlinists of Carinae also issued bounty vouchers for wanted ships, in order to protect the deliveries. Contributing pilots can now collect their rewards from Stillman Hub in the HIP 22550 system.

In related news, the first Marlinist Parliament has been democratically elected. The respected community leader Dr Jenna Fairfax was chosen by a majority public vote to be First Minister. In a public address, she said:

“This path was not chosen by us, but our people have turned Marlin Duval’s ideology into a functioning republican society. Now that we are fully independent members of the galactic community, we can repay those who aided our survival by offering discounts on commodities and establishing regular trading.”

Pilots Federation ALERT

Rival initiatives to arrange a diplomatic conference have been launched by Sirius Corporation and the Utopia commune.

The Alliance Assembly, Federal Congress and Imperial Senate have each provisionally agreed to send delegates to the first tri-superpower Galactic Summit in late February. This political gathering will also be attended by representatives from independent systems.

All parties have specified that their participation depends upon the event being successfully organised in neutral territory, and with sufficient resources and security in place.

Sirius Corporation and Utopia have begun to gather supplies to host the conference. Both have requested assistance from the galactic community to provide a broad range of data, which will be vital for planning security operations. Whichever organisation obtains the greatest amount of data will be deemed most suitable.

The following data sources are of interest to both parties: anomalous bulk scan data, atypical disrupted wake echoes, exceptional scrambled emission data and unusual encrypted files.

Simguru Pranav Antal has called upon all pilots who support Utopia’s proposal to deliver the data to Tanner Settlement in the Polevnic system.

CEO Li Yong-Rui has asked all those who believe Sirius Corporation to be a more suitable host to deliver the data to Goldstein Port in the Lembava system.

Councillor Nakato Kaine is visiting key systems across the Alliance as part of her bid to be elected as the next prime minister.

Of all the challengers to the incumbent Edmund Mahon, Kaine has the most support from fellow council members. She has represented the Tionisla system for nearly a decade, and is renowned for delivering forceful speeches before the Assembly.

Kaine’s disapproval of the expansionist policies in recent years has struck a chord with people in many systems. She also has a strong reputation among the ‘Old Worlds’, which are viewed as the historic hub of the Alliance.

During a political rally on Leesti, Councillor Kaine directly criticised her election opponent:

“Prime Minister Mahon clearly thinks that the Alliance must mimic the Empire’s arrogance and the Federation’s corporate greed. He has repeatedly led us into conflict with the Thargoid race, risking millions of lives so we could raid their territories like thieves in the night.”

“I believe that we should be inspired by the mutual cooperation that once made the Old Worlds thrive. We must invest in trade and security to benefit our member systems, instead of pretending to be a monolithic superpower.”

The Federal High Court on Mars has opened the trial of Fleet Admiral Lucas Vincent, who is charged with conspiracy to commit murder and treason.

Vincent stands accused of organising the sabotage of Starship One in 3301, resulting in hundreds of deaths.

The Federal Times’s crime correspondent Ethan Takahashi reported:

“The trial began with the prosecution counsel outlining the case. Material evidence obtained from Chief Technician Rory Webster, whose testimony led to Vincent’s arrest, was presented before the jury.”

“Vincent was questioned about a secure transmission from his office to the presidential vessel on the 24th of May 3301, ordering an unscheduled diversion to the Azaleach system for routine maintenance. This is where Webster’s engineering team followed Vincent’s orders to install the sabotaged hyperdrive component that caused the misjump.”

“Evading the questions, Vincent claimed that the entire trial was a ‘Liberal Party cover-up’ and that Starship One was destroyed ‘to put Winters in charge’.”

“With the loss of President Halsey and Vice President Naylor, Felicia Winters did indeed assume the role of acting president and became leader of the Liberal Party. However, the defence counsel played down these accusations, instead declaring that Webster’s recordings of Vincent’s orders could have been falsified.”

Former President Jasmina Halsey has taken the witness stand during the trial of Fleet Admiral Lucas Vincent at the Federal High Court.

Crime correspondent Ethan Takahashi reported the details for The Federal Times:

“Jasmina Halsey confirmed that the orders for Starship One’s unscheduled stopover in the Azaleach system came directly from Fleet Admiral Vincent. She added that the presidential itinerary was often altered for various mundane reasons, and at the time this seemed routine.”

“Halsey also provided an account of the vessel’s destruction, describing the chaos and panic onboard as the hyperspace misjump caused rapid structural disintegration. She praised her security detail for getting her into a cryogenic stasis pod and launching it moments before Starship One exploded.”

“During cross-examination, the defence counsel quoted her reported visions after being rescued, when Halsey described meeting the ‘caretakers of our galaxy’ and experiencing the ‘infinities of the cosmos’. It was suggested that the testimony of someone suffering from such obvious delusions should be discounted.”

“Halsey admitted that she no longer has any memory of making those statements, and may have been suffering from post-traumatic shock. She then provided the court with psychological reports and neural scans from the Alliance’s finest doctors, medically confirming that she is of sound state of mind.”

Pilots Federation ALERT

An encrypted message seems to provide planetary coordinates related to the mysterious signal from ‘Serene Harbour’.

The message received by the Pilots Federation was as follows:

Welcome to Serene Harbour. 56.4 latitude -8.3 longitude. Theta Seven.

Although this pinpoints a geographical area on a planetary surface, the astronomical location of this body remains a mystery. It is unclear whether ‘Theta Seven’ refers to additional map coordinates of some kind, or is a code-phrase intended for unknown recipients.

Little is known about the original distress call, other than its brief content:

"This is an emergency broadcast on all frequencies from Serene Harbour. We are – "

Pilots Federation ALERT

An independent vessel has detected a fragment of a mysterious message coming from an unexplored region of space.

Commander Elsa Solomon was travelling through the Swoilz XX-D c1-30 system when her ship’s communications array picked up a faint transmission. The message was as follows:

This is an emergency broadcast on all frequencies from Serene Harbour. We are –

The transmission ended abruptly and did not resume. The signal did not contain any identification data or indications as to its origin.

Commander Solomon gave more details to Vox Galactica:

“The message appeared in my comms panels as text and an electronically generated voice. I wasn’t able to determine a source, only that it was broadcast within 80 light years of that system. My schedule was tight so I couldn’t spend long tracking it.”

“I have no idea if Serene Harbour is a starport, a settlement or even a megaship, but this is obviously a mayday signal. Someone somewhere is in serious trouble. I’ve asked the Pilots Federation to share the information in case any of my fellow Commanders can help.”

To help triangulate the source, there is a callout to any other ships that were in the area at the time, which may have received a similar broadcast. However, no responses have been received as yet.

Pilots Federation ALERT

Sirius Corporation has received more data than Utopia and will therefore host the Galactic Summit.

Both organisations proposed to organise a diplomatic conference for the Alliance, Empire and Federation. After calling on the galactic community to gather data that would support security operations, many pilots handed in anomalous bulk scan data, atypical disrupted wake echoes, exceptional scrambled emission data and unusual encrypted files.

All three superpower governments confirmed that due to its success in preparing effective security systems, they will accept Sirius Corporation as the neutral territory for the conference.

CEO Li Yong-Rui made this announcement:

“Thank you to all the independent pilots who supported us. Sirius will now begin work preparing for the first Galactic Summit, which we hope will increase peace and prosperity across the galaxy.”

Pilots who delivered to Sirius Corporation can collect their rewards from Goldstein Port in the Lembava system.

Simguru Pranav Antal expressed disappointment, but confirmed that all who contributed to Utopia’s initiative will be rewarded at Tanner Settlement in the Polevnic system.

Sirius Corporation has stated that the Galactic Summit is provisionally scheduled to take place over a three-week period in late February and early March.

At the trial of Fleet Admiral Vincent, former President Jasmina Halsey has revealed possible reasons behind the sabotage of Starship One in 3301.

Crime correspondent Ethan Takahashi reported from the Federal High Court:

“Jasmina Halsey provided details of a top-level Federal Cabinet meeting in late April 3301, an event which was never declassified. Its aim was to address the high levels of public dissatisfaction with her administration.”

“At the meeting, Halsey explained that she had been inspired by various peace activists to refocus on the wellbeing of citizens. She planned to reduce taxes, invest in social infrastructure and slash Federal Navy spending. As yet this was only a preliminary plan, to be implemented later that year.”

“Halsey told the court that only a dozen officials were present at this meeting, including Fleet Admiral Vincent. All were told that this forthcoming sea change in policy was confidential, but to expect major budget changes in the coming months.”

“The prosecution counsel stated that Vincent was therefore aware that naval defunding was imminent, something which would reduce his personal influence. It would also impact powerful individuals who Vincent was illegally connected to, evidence of which would be presented in due course.”

The Alliance Assembly has agreed to delay electing a new Prime Minister to avoid clashing with the forthcoming Galactic Summit.

The proposal to postpone the election date came from Prime Minister Edmund Mahon:

“Now that the diplomatic conference has been confirmed, we must adapt to take advantage of this historic event. A potential change in leadership occurring at the same time as the Galactic Summit would cause confusion and undermine the Alliance’s presence.”

Although Mahon’s proposal was voted through by a narrow margin, many council members disagreed with altering the political calendar. Councillor Nakato Kaine, who is a candidate in the election, declared:

“It is outrageous that the Prime Minister is using this as an excuse to extend his term in office. Once again, he is more concerned with projecting the Alliance as a superpower than the interests of member systems. This behaviour is what you’d expect from a corrupt emperor or president, clinging onto power at any cost.”

The Assembly has rescheduled the election to take place three months later in May 3307, although this remains only provisional.

Evidence presented at the trial of Fleet Admiral Vincent suggested financial links to Federal shipbuilding corporation Core Dynamics.

This significant development was covered by Ethan Takahashi for The Federal Times:

“The initial investigations around Starship One’s destruction in 3301 were outlined by the prosecution. When the Federal Attorney’s Office revisited this historical data, traces were found of financial transfers routed through non-Federation banking systems.”

“The FAO brought in the expertise of the Wallglass Investigations Agency, which discovered that these transactions were made via shell companies created by Core Dynamics. Fleet Admiral Vincent, as well as several other naval officers, received billions of credits through these companies that went undeclared.”

“Vincent refused to answer any questions about this evidence, once again claiming that he is the victim of a conspiracy to hand the presidency to Felicia Winters.”

Despite multiple requests from the press, Core Dynamics has not made any public comment. There are unverified reports of large-scale activity taking place at some of the corporation’s centres of operation.

Pilots Federation ALERT

An Imperial Intelligence detention facility discovered in the R CRA Sector AF-A d42 system has been repudiated by the Empire.

The outpost, named Serene Harbour, was located after its distress call was shared publicly by the Pilots Federation. According to the Commander Andee-X- who first investigated the site, all its occupants were dead as the result of what appeared to be a prisoner breakout.

Unlike the Imperial Internal Security Service, the Imperial Intelligence organisation has no spokespeople or public channels. However, Senator Karl Nerva told the media:

“The claim that high-security prisoners and terrorists are being tortured for information in an unregistered outpost is categorically false. There is no such place as ‘Serene Harbour’.”

“We believe that independent pilots have been duped by a Federal ploy to undermine the Empire, using fake locations and logs for theatrical effect. I assure all citizens that Imperial Intelligence operates fully within the law and remains vigilant against all threats.”

When asked about Commandant Gabriel De Luca, who was identified by surviving logs at the outpost, Senator Nerva replied:

“Captain De Luca was indeed an agent of Imperial Intelligence, but died on active duty several years ago. It’s obvious that this respected hero’s identity has been stolen to add credibility to anti-Imperial disinformation.”

Pilots Federation ALERT

The engineer Liz Ryder has requested mined materials to help make a previously unique ship module widely available.

The module is a fully engineered lightweight and high capacity Class 2 Seeker Missile Rack with thermal cascade. It was offered in October 3306 to pilots who helped defend the Eurybia system from Imperial forces. At the time, the Empire suspected Liz Ryder of supplying weapons to the NMLA terrorist group.

Ms Ryder has announced that her aim is to make this specially modified weapon available for purchase at all human technology brokers. She added:

“Pilots can help kick-start this project by providing mined commodities, which will temporarily reduce the amount of materials that customers require to obtain the missile rack. As a bonus, the highest contributors to this initiative will be gifted with the module.”

“I’m pleased to be working with tech brokers to add this to the market. Many engineers think we could do more to serve the galactic community, and this is a step in that direction.”

Shipments of bromellite, lithium hydroxide, osmium and samarium can be delivered to Awyra Flirble in the Eurybia system.

Core Dynamics CEO Jupiter Rochester has been accused of collaborating with Fleet Admiral Vincent to orchestrate Starship One’s destruction in 3301.

As reported by Ethan Takahashi for The Federal Times:

“Financial data was presented to the court showing that Vincent, along with others in government and the Federal Navy, received colossal payments via shell companies created by Jupiter Rochester’s loyalists.”

“The prosecution claimed that Rochester and Vincent were reacting to then-President Jasmina Halsey’s intention to scale back military spending, which would impact Core Dynamics’s profits. They arranged to assassinate her and lay groundwork for Zachary Hudson to be voted into power, knowing that his policies would result in further naval contracts.”

“The defence argued that Halsey’s testimony was unreliable, and that the financial data was obtained via improper methods so should have been inadmissible. It was also pointed out that the Rochester family had many enemies determined to besmirch their reputation.”

“The jury has now been sequestered to determine a verdict. This means they are unaware of media reports that several Core Dynamics departments, known collectively as ‘Jupiter Division’, are transporting ships and personnel to the HIP 54530 system.”

Other sources confirmed that the HIP 54530 Gold Universal Group has officially assumed the name Jupiter Division, suggesting that it was heavily infiltrated by Rochester’s loyalists. The faction has retained control of the permit-locked HIP 54530 system.

Pilots Federation ALERT

This is an emergency bulletin to alert independent pilots that kidnappers are operating in the vicinity of the HR 6828 system.

The Pilots Federation has received reports of untrustworthy offers being made to Commanders who recently obtained their pilot’s licence.

These involve the owners of Drake-class fleet carriers enticing a pilot to outfit their ship for mining operations, before docking with the larger vessel. It then makes a series of jumps, to a distant star system over 800 light years away, taking the docked ship with it.

The Commander is encouraged to work on mining hotspots in order to produce income for the fleet carrier. However, their own ship’s limited jump range means they are effectively marooned, and reliant upon the fleet carrier to be returned to their starting system.

All pilots are therefore advised to beware of hails directing them to HR 6828 or systems in that area. It is also important to exercise extreme caution when docking with any fleet carrier whose owner is unknown.

The Pilots Federation has requested that this bulletin be shared by all members across public channels. It has also been distributed to major newsfeeds including The Alliance Tribune, The Federal Times, The Imperial Herald and Vox Galactica.

A Federal High Court jury has found Fleet Admiral Lucas Vincent guilty of conspiracy to commit murder and treason.

The court heard how Vincent worked with Core Dynamics CEO Jupiter Rochester to sabotage Starship One and assassinate then-President Jasmina Halsey, in order to increase military contracts.

The Federal Times’s crime correspondent Ethan Takahashi observed:

“Within minutes of Vincent receiving a life sentence, Federal Intelligence Agency teams arrested several co-conspirators in the Federal Navy along with some government officials.”

“Jupiter Rochester himself has evaded arrest by fleeing to the HIP 54530 system, where loyalists within Core Dynamics are establishing a breakaway faction named Jupiter Division. Industry analysts believe that this corporate split has long been planned, but is being accelerated because of the trial.”

“Rochester’s responsibility for the Starship One tragedy raises many questions, especially for his powerful family. It will certainly fuel the conspiracy theory that he is a member of a covert group of powerful figures, who manipulate events to benefit the military/industrial complex.”

“However, a more plausible theory – that Zachary Hudson was responsible – now seems to have been debunked. Nothing presented in court suggested that the president had any involvement in, or knowledge of, the plan to eliminate his predecessor.”

Several departments loyal to the Core Dynamics CEO have seceded to form an independent corporate republic called Jupiter Division.

During the recent trial of Fleet Admiral Vincent, Jupiter Rochester was named as the paymaster behind the sabotage of Starship One. This hastened long-term plans to abscond from Core Dynamics along with many ships and personnel.

In the permit-locked HIP 54530 system, the HIP 54530 Gold Universal Group has been renamed as Jupiter Division. It is assumed to have long been infiltrated by Rochester’s loyalists.

Using the new self-appointed title of Supreme Executive Rochester, he broadcast this statement across all Federal media channels:

“For many years, I helped Core Dynamics become one of the galaxy’s strongest companies, but petty laws and bureaucracy restricted me at every turn. I have always felt that people should not be ruled by politicians, but by those holding true economic power – the corporations.”

“It will be a long time before I can act on my commercial plans, but I will prove that corporate rule is the most beneficial system of governance for the Federation.”

Jupiter Rochester is the eldest son of Shadow Vice President Isolde Rochester, and a key member of the influential Rochester family. As yet there have been no public statements from his mother or siblings.

The acquisition of Lakon Spaceways by Core Dynamics has been revoked following revelations of illegal activity.

An inquiry by the Independent Commission for Market Equality stated that former Core Dynamics CEO Jupiter Rochester “exerted unduly influence on Lakon shareholders, including bribery and blackmail”. This led to new appointees to the board of directors, who were paid to approve the hostile takeover.

The inquiry also factored in the recent Federal High Court trial, which proved that Jupiter Rochester was directly responsible for the destruction of Starship One in 3301. In both cases, he set up shell companies to move enormous funds via unregistered banking systems.

Core Dynamics refused to comment on the allegations, but its legal team has terminated the transfer process. The entire corporation is currently in disarray due to several departments becoming an independent faction under the name Jupiter Division.

At Lakon Spaceways, Trent Delaney and several other directors have resigned. During an emergency meeting, a majority of stakeholders approved reinstating Naomi Landseer as chairperson.

With stock values plummeting and industry confidence low, the future of the company remains uncertain. However, Sirius Corporation confirmed that it has made preliminary offers with regards to acquiring Lakon as a subsidiary.

Pilots Federation ALERT

Jupiter Division ships have engaged in battle with rival Federal vessels in the HIP 54530 system.

Loyalists to former Core Dynamics CEO Jupiter Rochester have built their own breakaway faction in HIP 54530. The FIA suspects that Jupiter Division agents first infiltrated the HIP 54530 Gold Universal Group years ago, and permit locked the system to conceal their efforts to overtake it from within.

The self-appointed Supreme Executive Rochester declared:

“The Federation is choking to death on its outdated bureaucracy – only corporate rule can save it! But first the galactic community must protect my followers, so I can establish a permanent base of operations.”

Director Theodore Sullivan of the Silver Legal Group announced:

“We will not tolerate these criminals illegally controlling this system. Once victory is won, the Federation will be able to bring Rochester to justice.”

Jupiter Division has offered generous rewards to any pilots willing to help secure its presence in the HIP 54530 system. The Silver Legal Group has asked Federal auxiliaries to support its efforts to degrade Jupiter Division’s military force.

The Pilots Federation has agreed to supply all ships participating in this conflict with temporary permits to access HIP 54530. These will expire early on Thursday the 18th of February 3307.

However, neither permanent nor temporary system permits apply to fleet carriers, since they are capable of ferrying vessels which could evade detection and authorisation.

Pilots Federation ALERT

Deliveries of mined materials have allowed the engineer Liz Ryder to make a one-off modified ship module widely available.

The module is a fully engineered lightweight and high capacity Class 2 Seeker Missile Rack with thermal cascade. It was only available for a brief period in October 3306, but can now be purchased from any human technology broker.

Freshly mined bromellite, lithium hydroxide, osmium and samarium were delivered by a large number of pilots. Due to the volume of shipments received, the initial amount of materials required by customers to purchase the weapon has been temporarily reduced.

Liz Ryder made this statement from her Demolition Unlimited workshop:

“Thank you to everyone who helped launch – so to speak – this module onto the market. I hope that engineers and tech brokers can continue working together on providing more options to the galactic community.”

Pilots who delivered commodities for this initiative can now collect their rewards from Awyra Flirble in the Eurybia system.

Delegations have been formed by the Empire and the Marlinist Colonies to take part in the forthcoming diplomatic conference.

Emperor Arissa Lavigny-Duval will not attend in person, but will be directly represented by Chancellor Anders Blaine. During the conference, Senator Zemina Torval will temporarily assume chancellor duties and act as head of the Senate.

In addition, Princess Aisling Duval and Senator Denton Patreus will be in attendance. They will be accompanied by experienced ambassadors from the Imperial Diplomatic Corps.

The Marlinist Colonies have also finalised their delegation, which includes First Minister Jenna Fairfax and Minister Aaron Whyte. A spokesperson for the Marlinist Parliament said:

“The Galactic Summit offers us an opportunity to engage with the Empire diplomatically, and we sincerely hope our voices will be heard. We also aim to establish mutually beneficial relations with other governments.”

There is widespread speculation on how the Empire will respond to political overtures from its own ex-citizens, who were persecuted for following the democratic ideology of Marlinism. However, most societies within the Marlinist Colonies still remain culturally Imperial in nature, despite their republican governance.

The Galactic Summit is being hosted by Sirius Corporation and will officially commence on Thursday the 25th of February 3307.

Federal citizens are in uproar after the former CEO of Core Dynamics was revealed to have destroyed Starship One to increase company profits.

The trial of Fleet Admiral Vincent showed that Jupiter Rochester attempted to replace Jasmina Halsey with Zachary Hudson to secure military contracts with the Federal Navy.

The Federal Intelligence Agency has arrested several co-conspirators, but its investigation is hampered by Jupiter Rochester loyalists splitting away from Core Dynamics. His new independent faction, Jupiter Division, has engaged in conflict against Federal forces in the HIP 54530 system.

President Hudson has claimed ignorance of the assassination plot, but public opinion polls show a decrease of trust in the Republican Party. Many have voiced anger at such corruption at the heart of the Federation, calling for further investigations into the corporate sector’s influence on government.

Political embarrassment has also affected the Liberal Party, with Shadow Vice President Isolde Rochester attempting to distance herself from her eldest son:

“Jupiter’s horrendous actions were his alone, made completely without our knowledge. My whole family is appalled at his illegal activity. We have offered to aid the authorities in bringing him to justice.”

The Alliance Assembly has approved purchasing a majority sharehold in Lakon Spaceways, gaining partial ownership of the shipbuilding company.

An acquisition attempt by Federal corporation Core Dynamics was recently revoked due to illegal practices by its former CEO Jupiter Rochester. The Alliance has now rescued Lakon from possible insolvency, using government funding to buy shares and increase investment.

Naomi Landseer, the reinstated chairperson of Lakon’s board of directors, announced:

“We welcome becoming closer partners with the Alliance, which we see as a natural progression following successful collaboration on past projects. I’m pleased to inform customers that the manufacture of Lakon vessels will continue uninterrupted.”

Although some Assembly members voted against the decision, including election candidate Nakato Kaine, there is broad public and industry approval. The Council of Admirals has expressed gratitude that a key defence contractor will not be controlled by another superpower or corporation.

Much of Lakon’s personnel and resources will migrate to Alliance space, although its range of ships will remain available for purchase across the galaxy. Plans to construct a new headquarters for Lakon Spaceways within the Alioth system are well underway.

Pilots Federation ALERT

Jupiter Division, the breakaway faction from Core Dynamics, has been defeated in the HIP 54530 system.

The independent corporate nation met armed resistance from a local faction, the Silver Legal Group, which defeated them in battle with the aid of independent ships. Director Theodore Sullivan announced:

“Thanks to the courage of many pilots, we have crippled the military forces behind this illegal coup and taken control of the system.”

Rewards for all who fought for the Silver Legal Group are available from the Iron Wings of Justice megaship in the Ts'ao Tach system.

The Silver Legal Group has been awarded permit control to prevent any further compromise of Federal assets. Pilots without this permit can perform missions for the faction at the Iron Wings of Justice megaship in Ts'ao Tach to access the HIP 54530 system.

Remnants of Jupiter Division confirmed that despite their defeat, all those who sided with them during the conflict will be reimbursed at the Victory’s Forge megaship in the HIP 55014 system.

The Federal Intelligence Agency has taken Jupiter Rochester into custody, where he will be charged for his involvement in the destruction of Starship One in 3301. Thousands of his loyalist followers have also been apprehended, and the return of stolen Core Dynamics ships and resources is being arranged.

Pilots Federation ALERT

The capital system of the Alliance now hosts Lakon’s administrative hub and offers a 5% discount on its ships.

The company’s main offices have been relocated to the Lakon Spaceways Central planetary port on Alioth 1 a.

All shipyards within the Alioth system are offering a permanent 5% discount on sales of vessels manufactured by Lakon. Pilots will need to obtain a permit for Alioth to take advantage of this reduction.

Both the move and the discount reflect the Alliance’s recent purchase of a majority sharehold in the company. This was primarily to retain it as a key defence contractor for the Alliance Defence Force.

Naomi Landseer, chairperson of the board of directors, announced:

“We are extremely pleased to be partnered with the Alliance, especially after recent tumultuous events. Lakon’s highly regarded ships will remain available across the galaxy.”

The attempted takeover of Lakon Spaceways by Core Dynamics was revoked due to revelations of illegal practices by its former CEO, Jupiter Rochester. Federal news sources have reported that a rapid restructure is taking place within Core Dynamics, alongside investigations by the Federal Intelligence Agency.

President Zachary Hudson and Shadow President Felicia Winters will both attend the diplomatic conference in the Sirius system.

The Federation will also be represented by ambassadors from the Federal Diplomatic Corps, as well as several civil and corporate interests.

Political correspondent Sofia Trevino reported for The Federal Times:

“President Hudson’s personal presence at the Galactic Summit sends the message that he still holds the reins of power. He clearly hopes that facing off against the Empire’s leaders will distract the public from the recent Jupiter Rochester scandals.”

“In his absence, Vice President Brad Mitchell will oversee congressional matters. There are rumours that Mitchell is positioning himself to challenge Hudson as the Republican Party candidate in the next election.”

“The conference also offers opportunities for Felicia Winters to appear presidential. She has eagerly agreed to meet the Marlinist Colonies delegation, having coordinated humanitarian aid for the refugees last year.”

“Winters has not asked Shadow VP Isolde Rochester to accompany her, perhaps as a rebuke for the criminal actions of her son. Furiously working on damage control for her family’s name, the Rochester matriarch has taken Jupiter’s two children into her care after his husband, Tomas Turai, filed for immediate divorce.”

The postponement of the election for a new prime minister has led to widespread public disorder across Alliance systems.

The Alliance Assembly vote was scheduled for Thursday the 25th of February. This date clashed with the start of the Galactic Summit, causing incumbent Prime Minister Edmund Mahon to propose that the election be delayed for three months.

On many Alliance worlds, large-scale protest marches have placed pressure on local police forces. Some civil leaders have condemned Mahon for using the diplomatic conference as an excuse to extend his term of office.

Mahon has referred to the unrest as being caused by a “vocal minority of agitators”, and insisted that the delay is in the Alliance’s best interests.

Councillor Nakato Kaine, Mahon’s main rival, has given the protests her full support. She has become a figurehead for public dissent, with some political pundits suggesting that she might have won the election had it been held this week.

Speaking to The Alliance Tribune, Councillor Kaine said:

“This is the latest in a string of short-sighted decisions, and it’s clear that the people no longer trust their prime minister. For this reason, despite believing the Galactic Summit to be a waste of time, I will be attending the conference to ensure that Mahon’s agenda does not dominate proceedings.”

Pilots Federation ALERT

The Federation is working with Sirius Corporation to offer bounty hunting opportunities to protect the diplomatic conference.

The first Galactic Summit has officially opened at Patterson Enterprise station in the Sirius system. Temporary permits have been issued to all arriving delegates and Commanders for the three weeks of its term, although these do not apply to fleet carriers.

Sirius Corporation’s CEO Li Yong-Rui announced:

“The data supplied to us in January revealed several unanticipated threats, putting additional strain on our navy and security forces. Working with the generous support of the Federation, we have placed bounties on all wanted ships to ensure delegates’ safety. Pilots defending the Sirius system will be rewarded for handing in bounty vouchers at the Spirit of Laelaps.”

The joint initiative will run for one week, after which Sirius Corporation will partner with the Empire to provide for the needs and security of the conference.

In related news, Core Dynamics, Gutamaya and Lakon Spaceways are celebrating the political gathering of all three superpowers with a 10% discount on their ships during the next three weeks.

Delegations have begun to arrive and formal introductions are taking place, with much media attention. This is the first time that universally recognised figures such as President Zachary Hudson, Prime Minister Edmund Mahon and Princess Aisling Duval have been seen side by side.

Pilots Federation ALERT

A wide range of luxurious food and drink for the Galactic Summit has been delivered to the Sirius Corporation.

Orders were placed for Eden Apples Of Aerial, Ethgreze Tea Buds, Gerasian Gueuze Beer, Giant Irukama Snails, Goman Yaupon Coffee, Karsuki Locusts and Lavian Brandy. Large quantities of these rare items were shipped to Ashby City in the Luyten’s Star system.

The consumables will be ferried to the nearby Sirius system, where the diplomatic conference will take place. This initiative was considered a priority, since some delegates only agreed to attend if their requests for these rarities were met.

CEO Li Yong-Rui has expressed his personal thanks to all pilots who delivered the rare goods, who can now collect their payment at Ashby City in the Luyten’s Star system.

Sirius Corporation has been organising the Galactic Summit for the past month, which has involved increased freight runs into its home system as well as heightened security. Preparations are now complete, and the first ambassadors from the Alliance, Empire and Federation are on their way.

Alliance, Empire and Federation leaders have held their first ever face-to-face discussions at the diplomatic conference in the Sirius system.

Political correspondent Conrad Sterling published this report for Vox Galactica:

“The Galactic Summit has already made history by bringing together many political figureheads within one conference chamber. Optimistic opening statements from Chancellor Anders Blaine and Prime Minister Edmund Mahon gained applause. President Zachary Hudson was more curt, reminding everyone that billions of people would be affected by their efforts.”

“Agendas and debate topics for the next three weeks were formalised. Much of the work will be done behind the scenes by ambassadorial staff, making big decisions in small rooms.”

“The general tone so far has been courteous, although that may not last. Predictably, interactions between the Imperial and Marlinist delegations have been frosty, with Senator Denton Patreus refusing to even acknowledge their presence during discussions.”

“However, First Minister Jenna Fairfax enjoyed a more cordial meeting with Shadow President Felicia Winters. They were joined by Jasmina Halsey, who has accompanied Winters from Mars in an unofficial capacity.”

“One notable absentee was Federal Ambassador Jordan Rochester, whose family is under legal scrutiny following the crimes of his older brother Jupiter Rochester. This at least spared Jordan the awkwardness of having to formally greet his ex-fiancée, Princess Aisling Duval. But it’s likely there will be no shortage of tension between other delegates in the coming weeks.”

Delegates at the diplomatic conference have clashed over long-standing political issues, with some threatening to abandon the event.

Journalists at Patterson Enterprise in the Sirius system reported their observations via mainstream newsfeeds.

The Imperial Herald: “Minister Whyte’s claim that the Empire had fomented terrorism by repressing Marlinism was somewhat predictable. But nobody expected Princess Duval’s icy retort, which caused shocked gasps across the chamber.”

Sol Today: “President Hudson easily dealt with Patreus’s whine about the Federation’s so-called ‘war-mongering’, putting the bombastic Imp in his place.”

Eye on Achenar: “The dull-witted thug of a president was no match for Senator Patreus, who received cheers for his condemnation of typical ‘Fedneck’ arrogance.”

The Alliance Tribune: “The conference’s hosts were visibly embarrassed by Councillor Kaine’s claims that Coalsack Nebula terraforming projects had triggered recent Thargoid attacks. Shockingly, several delegates dismissed this as an internal matter for the Alliance.”

The Federal Times: “Chancellor Blaine’s stonewalling on the co-funding of humanitarian aid brought a rare flash of anger from Felicia Winters: ‘Maybe the Emperor’s puppet could loosen a few strings?’”

The Sovereign: “Despite Prime Minister Mahon exaggerating the benefits of Alliance membership, several independent ambassadors complained about its incomprehensible bureaucracy, saying it would be less damaging to declare war against the Alliance than join it.”

A representative from Sirius Corporation reported that the Galactic Summit was “going well”.

Leaders from the Alliance, Empire and Federation have agreed a series of minor treaties at the diplomatic gathering in the Sirius system.

Vox Galactica featured this report from political correspondent Conrad Sterling:

“Following days of heated arguments, temperatures in the conference chamber finally cooled enough for all three superpowers to formalise a raft of agreements. These were ratified in person by Chancellor Blaine, President Hudson and Prime Minister Mahon.”

“The most significant of these treaties is the Cornelius-Lasky Convention, named after its two leading proponents. This requires the Alliance, Empire and Federation to share information on any large-scale threats to civilian populations, including environmental, medical and xenological crises.”

“There has been slow progress on other topics, such as military limitation and border control. Many independent ambassadors are demanding to prioritise debates on the Thargoid issue, and especially the defensive role played by Aegis.”

“Outside the chamber, First Minister Fairfax invited Princess Duval to a small ceremony to honour her late father. Fairfax formally apologised for Prince Harold’s death and condemned the terrorists responsible. Aisling Duval gracefully accepted this, but time will tell if it was an empty gesture or the first step toward Imperial-Marlinist rapprochement.”

Pilots Federation ALERT

The Empire is aiding Sirius Corporation by offering bounty hunting and trade opportunities to support the Galactic Summit.

The diplomatic conference is now entering its second week, with superpower and independent leaders gathered at Patterson Enterprise in the Sirius system.

Sirius Corporation’s CEO Li Yong-Rui announced:

“Our thanks to the Federation for organising additional security against unexpected numbers of vessels this past week. Anarchic extremists, political enemies and opportunistic criminals all attempted to disrupt the conference to no avail. Pilots who helped maintain the peace can collect their rewards at the Spirit of Laelaps.”

“For the coming week, we are working with the Empire to maintain the security operation by offering bounties on all wanted ships. The Empire will also pay generously for extra supplies of animal meat, coffee, fish, fruit and vegetables, and wine that are delivered to the Spirit of Laelaps.”

Pilots are reminded that neither permanent nor temporary permits to enter the Sirius system apply to fleet carriers. This joint initiative will run for one week, followed by Sirius Corporation partnering with the Alliance for the final week of the Galactic Summit.

In related news, Core Dynamics, Gutamaya and Lakon Spaceways are continuing to offer a 10% discount on all their ships to mark the historic occasion.

04 MAR 3307
Pirate warlord Archon Delaine has unexpectedly appeared at the diplomatic conference and demanded to participate as a political delegate.

Delaine is the leader of the Kumo Crew, a notorious crime syndicate that controls dozens of systems. Their arrival at Patterson Enterprise station initially caused many delegations’ security teams to begin evacuations.

However, representatives of the Sirius Corporation called for calm and delivered this message:

“We have vouchsafed Archon Delaine’s presence and extended full diplomatic immunity to his retinue. As with all attendees, they are expected to abide by our rules and etiquettes.”

This reassurance did not prevent several ambassadors from walking out in protest. Some accused Sirius Corporation of striking a deal with Delaine to prevent even more pirate vessels from swarming through the Sirius system.

Mainstream newsfeeds also covered the impact of Delaine’s arrival.

The Imperial Herald: “Senator Patreus officially complained about ‘the repulsive sight of pirate scum strolling alongside respectable politicians’. However, Chancellor Blaine agreed that Delaine could address the conference, albeit under close scrutiny.”

The Federal Times: “Neither Hudson nor Winters have commented on Delaine’s appearance, but the security chief for the Federal delegation remarked: ‘One wrong step and we’ll put some big holes right through their immunity.’”

The Alliance Tribune: “This is an unwelcome distraction from Prime Minister Mahon’s proposal for Aegis’s remit to be enormously expanded. The Sirius Treaty will fully unite superpowers, corporations and independent systems against the Thargoids – assuming that Mahon can convince his fellow leaders to agree.”

Former Core Dynamics CEO Jupiter Rochester has received a summary judgement for multiple crimes against the Federation.

The Federal Justice Department gave this statement:

“The facts in the case of Jupiter Rochester are self-evident. His principal role regarding Starship One and Jupiter Division make him guilty of treason, mass murder and many other crimes. He will serve a solitary life sentence in a maximum security prison.”

Milandu Okoro of the Federal Attorney’s Office expressed surprise:

“It is highly unusual for the FJD not to litigate such a major case, considering we don’t know the full extent of Rochester and Fleet Admiral Vincent’s conspiracies. Unfortunately, our request to open a full investigation has been denied.”

Shadow Vice President Isolde Rochester has reiterated that her family were not involved with her eldest son’s clandestine activities.

Core Dynamics is continuing to rebuild after several departments separated to form Jupiter Division. Owen McKenna, the new CEO, has vowed to purge the company of all his predecessor’s loyalists.

Despite Rochester’s failure to build a powerbase in the HIP 54530 system, his manifesto of placing the Federation under direct corporate rule has received praise in some regions. A corporatist movement, founded by commercial networks and civil groups, is gradually gaining popularity.

At the Galactic Summit, the infamous pirate leader Archon Delaine has demanded to be accepted as the legitimate leader of a political power.

A gap in the schedule allowed him to make an address in the main conference chamber:

“Most of you see me as a common criminal, rather than the rightful ruler of multiple systems. That must end now! My efforts to build a Kumo nation deserve respect. I am here to declare my sovereignty and take my rightful place on the political stage.”

This was immediately dismissed by many delegations. Princess Aisling Duval said this was a barbaric mockery of nobility, while Shadow President Winters asked how much bloodshed the pirates had caused to obtain their power. Archon Delaine replied:

“Are you all so innocent, then? Every civilisation begins with barbarism, and maintains authority with the threat of violence. None of you can say otherwise. We all wear a crown of bones.”

There followed intense debate as to whether the Kumo Crew’s territory could be recognised as a new nation-state or was simply a rebranded crime syndicate. There is suspicion that some of the many criminal vessels detected in the Sirius system are from Delaine’s pirate fleet.

The Federal and Imperial delegations have offered to remove Archon Delaine’s retinue, only to be reminded that Sirius Corporation has granted them full diplomatic immunity.

Potential solutions to the threat posed by the Thargoid race are being debated at the diplomatic conference in the Sirius system.

Political correspondent Conrad Sterling reported for Vox Galactica:

“As always, the topic of the Thargoids brings division. The Alliance delegation has portrayed the aliens as a universal danger, while the Empire and Federation took a more balanced view.”

“Professor Alba Tesreau’s plea to increase support for Aegis was well received, but many delegates argued that further anti-xeno breakthroughs were needed to justify additional funding. To this end, Aegis will undertake new research into the Guardians, hoping to discover a technological advantage from that ancient species.”

“Prime Minister Mahon’s proposal for strategic cooperation against the Thargoids – known as the Sirius Treaty – is now being examined in detail. Supporters view it as a logical progression from the recently agreed Cornelius-Lasky Convention.”

“There was minor uproar when Archon Delaine agreed to be a signatory. Coupled with similar commitments from the Marlinist Colonies and other independents, this has brought pressure upon the Empire and Federation to follow suit.”

“If ratified, the Sirius Treaty could be the crowning achievement of the conference. However, putting it into practice will require a huge influx of resources. Decisions are expected before the end of this week.”

Erik Gunnarson and Francesca Wolfe, two detectives from the Wallglass Investigations Agency, examine the background of the Adamastor megaship.

Gunnarson: “When Wolfe and I started this project, we knew this case would come first. We’re both protégés of Benjamin Chester, creator of the Wallglass Archive. He retired years ago, but that old spark kicked in when a ‘ghost ship’ turned up on his doorstep!”

“The Adamastor is a 200 year old derelict that drifted into the Chukchan system on autopilot. It’s still there, with the Alliance Salvage Guild poking through its guts. Chester investigated its owners, a super-secretive company called Azimuth Biochemicals. We don’t know what they were searching for, but what they found was possibly the first recorded Thargoid encounter.”

“I’ve since tracked down evidence that the Adamastor had a sister ship – the Hesperus – which in 3113 was sent to… somewhere! Neither ship returned, but we only know what happened on the Adamastor mission. Of course, Wolfe had to go see that with her own eyes.”

Wolfe: “Musca Dark Region PJ-P b6-1 is a busy system nowadays, but was unexplored when Professor Carver’s survey team were there. Listening to their logs from two centuries ago while examining the research base was chilling… ghost voices from a ghost ship.”

“There was evidence of blast scars, but I’ve seen enough battlefields to know what exchanged gunfire looks like. Azimuth’s mercenaries weren’t just firing at Thargoids, but at someone who shot back with laser rifles.”

“Gunnarson tells me Azimuth was swallowed up by a rival called Pharmasapien. Did they infiltrate the Adamastor and try to take over? Or did the thing that Carver captured drive everyone insane?”

“This is a seriously cold case, even for us. But maybe one day, more tantalising clues will emerge. And that’s what we live for.”

Pilots Federation ALERT

Explosions have struck starports across the Alliance, Empire and Federation in a coordinated bombing attack by the NMLA.

The capital systems of all three superpowers – Achenar, Alioth and Sol – have been targeted by the terrorists, as well as six other high-population systems. Precise casualty numbers are unavailable, but several hundred thousand people have been killed with many more injured.

There are urgent calls for independent pilots to rescue survivors and support repair operations at all nine locations:

Dawes Hub in the Achenar system

Donaldson in the Alioth system

Dublin Citadel in the Gateway system

Hahn Gateway in the Nanomam system

Ito Orbital in the Rhea system

Lave Station in the Lave system

Li Qing Jao in the Sol system

Parkinson Dock in the Eotienses system

Shajn Market in the Kamadhenu system

The explosive damage to each station is consistent with corrosive enzyme weapons previously used by the NMLA. This has triggered automated systems designed to respond to Thargoid assaults.

The Alliance Defence Force, Federal Navy and Imperial Navy are on full alert. Other military and security forces across the core systems are preparing for possible further attacks.

The Galactic Summit has been temporarily suspended while Alliance, Empire and Federation leaders respond to the emergency. A full lockdown is in effect in the Sirius system, where the scheduled bounty hunting and trade initiatives have been cancelled.

The conference in the Sirius system has ended prematurely after terrorist bombings against nine starports across the Alliance, Empire and Federation.

Sirius Corporation confirmed that the cancellation was due to fears that Patterson Enterprise station may be the next target. All scheduled business, including finalising the Sirius Treaty, has been halted. The delegations are returning to their home systems under high security.

Temporary permits for the Sirius system will remain in place for one week. Pilots who contributed to the security and trade initiatives held in partnership with the Empire can collect their rewards at the Spirit of Laelaps. Core Dynamics, Gutamaya and Lakon Spaceways will continue to offer a 10% discount on all their ships for one more week.

The Neo-Marlinist Liberation Army has claimed responsibility for the simultaneous attacks in nine systems, including superpower capitals Achenar, Alioth and Sol.

The following message was broadcast on NMLA propaganda channels:

“I no longer have a name. Nor a family. Nor a future. Each taken by the Empire. Now all I have is the dehumanising number printed on my uniform in their torture chambers. Now all I am is Theta Seven.”

“The Alliance and Federation’s rulers have revealed themselves as imperialist supporters of the Duval dynasty, which has crushed our ideals for a thousand years. Peoples of the galaxy – you can change this. We give you your own Nine Martyrs. Use them to retake control and regain your power.”

Media newsfeeds are detailing the impact and implications of the attacks. There is speculation that NMLA activists were concealed among Marlinist refugees that fled to Alliance and Federation space to escape Imperial persecution.

The Marlinist Parliament has officially stated it has “no connection to Neo-Marlinist extremists”, and that it will cooperate with security and emergency services during this crisis.

Vice President Brad Mitchell and a number of Federal Cabinet members have been killed in the recent terrorist attack on a starport orbiting Earth.

The NMLA planted caustic enzyme explosives at Li Qing Jao station, where a government meeting was taking place. The VP and Cabinet members were confirmed to be among tens of thousands of casualties. Eight other starports across all three superpowers were simultaneously bombed.

President Zachary Hudson, who was attending the Galactic Summit during the attack, made this statement:

“This atrocity is nothing less than a declaration of war, and we will respond accordingly. For now, we mourn the loss of my close friend Brad Mitchell and other heroes of the Federation. I will personally appoint replacements to their positions soon.”

The Federation has directly accused the Empire of being responsible, by allowing Neo-Marlinist bomb-makers to escape from a secret prison facility. The Imperial Senate reiterated that ‘Serene Harbour’ does not exist and is part of a Federal disinformation campaign.

Followers of Marlinism have also received much public criticism. The Marlinist Colonies have repeatedly stressed that they do not support the NMLA and are unconnected to the attacks.

Independent pilots have been asked to assist rescue and repair operations in the Achenar, Alioth, Eotienses, Gateway, Kamadhenu, Lave, Nanomam, Rhea and Sol systems.

Political fallout has been intense after the NMLA simultaneously bombed nine starports in the Alliance, Empire and Federation.

The targeted stations are in the Achenar, Alioth, Eotienses, Gateway, Kamadhenu, Lave, Nanomam, Rhea and Sol systems. These were referred to by NMLA propaganda as the ‘Nine Martyrs’, a reference to the attack against Kepler Orbital last November.

All three superpowers are treating this as a major emergency. Top-level discussions have taken place between their chiefs of security, using communication protocols recently established at the Galactic Summit.

However, mainstream media has also reported on internal political tensions.

The Imperial Herald: “Senator Patreus proposed that all known Marlinists be arrested immediately as NMLA collaborators. He received a direct rebuke from Chancellor Blaine, who said ‘Her Majesty views your blunt tactics as having been counter-productive, and requires more creative solutions.’”

The Federal Times: “President Hudson opened Congress with a minute’s silence to honour VP Brad Mitchell and other deceased Cabinet members. He then directly blamed Shadow President Winters for their deaths, claiming ‘You invited terrorists with your virtue-signalling aid programme for fake refugees!’”

The Alliance Tribune: “The Assembly broadly welcomed Prime Minister Mahon’s call for unity against the NMLA, and praised his efforts on the Sirius Treaty despite it remaining unsigned. But there was also support for Councillor Kaine’s viewpoint: ‘Our entry fee for the Galactic Summit was hundreds of thousands of lives.’”

The Alliance, Empire and Federation have created a centralised agency dedicated to investigating and eliminating the NMLA paramilitary group.

The new Affiliated Counter-Terrorism unit (ACT) is a direct result of the Cornelius-Lasky Convention, which was signed at the Galactic Summit.

This treaty requires the superpowers to share information on any large-scale threats to civilian populations. With a combined death toll rising over half a million, the recent starport bombings have obtained such status.

ACT will be jointly led by the veterans of the tri-superpower taskforce that defeated the League of Reparation in 3304: Captain Niamh Seutonia of the Imperial Internal Security Service, Inspector Mara Klatt of Alliance Interpol, and Senior Agent Tanya Ramirez of the Federal Intelligence Agency.

Captain Seutonia gave a brief statement:

“ACT is an independent organisation dedicated to bringing the NMLA to justice. We will draw resources from Alliance, Empire and Federation security forces and elsewhere.”

“However, we foresee the need for even larger numbers of dedicated personnel. Therefore, we have contacted the Pilots Federation for permission to invite independent pilots to gather information for us when necessary.”

Pilots are advised that civilians still require transportation from damaged starports in the Achenar, Alioth, Eotienses, Gateway, Kamadhenu, Lave, Nanomam, Rhea and Sol systems.

Safeguard Interstellar requires deliveries of medicines to treat casualties from the NMLA’s recent terrorist attack.

The humanitarian aid organisation is helping to coordinate relief efforts for the starports in the Alliance, Empire and Federation that were bombed last week. CEO Noel Beaumont announced:

“Hundreds of thousands of civilians still require urgent medical attention after being evacuated from the damaged stations. Many have severe caustic burns inflicted by the corrosive enzyme payload of the explosives. We have already exhausted the majority of supplies in nearby systems.”

“To reinforce overstretched health services, we request shipments of basic medicines and advanced medicines. These can be delivered to three starports being used as staging areas: Krylov Ring in the He Bo system, Mackenzie Relay in the Cemiess system, and Davis Terminal in the Duamta system.”

Safeguard Interstellar has partnered with three local factions – Perez Ring Brewery, Lavigny's Legion and the Duamta Gold Creative Corp – to reward pilots and distribute the medicines within each superpower.

Pilots can provide further help by directly delivering repair materials to damaged starports in the Achenar, Alioth, Eotienses, Gateway, Kamadhenu, Lave, Nanomam and Rhea systems. Li Qing Jao station in the Sol system remains an active disaster zone, with civilians still requiring evacuation.

100K Character Limit reached
 
Last edited:
Appendix
Marlinist Systems News.png
Marlinist Systems News 2.png
Marlinist Systems News 3.png
Marlinist Systems News 4.png




Credit to The GalNet News Digest & Rainbro for the original source and info:


https://i.Please use another image host/mutbHGW.png

Not sure who found it first, happy to credit if found.

Creditt to Factabulous again.

1603211419272.png

Credit to Factabulous for this find:
IMG-20201021-002509.jpg

Credit to Jmanis for these:


1603280824002.png


1603281298667.png


1603281637527.png


1603282154462.png


1603282466522.png


1603283300545.png

26th to 28th Oct 3306 - There were some binary codes on Instagram that made up a 3x3 grid shown here, credit to @J4nB1 for original:
1604152765693.png

that translated in Binary:


to
'Coalsack Nebula. The stones. He keeps watching the stones. '

Then we got an Audio message from Dr Murphy, a Geologist and member of a Survey Team led by Professor Carver and that 'I think theyre all dead'

Source: https://twitter.com/i/status/1321500318434238465


Then we got the GalNet article on 29th Oct 3306 about a 'Ghost Ship' called Adamastor in Chukchan. Local news leads towards Barnards Star on a route through 2 systems with journey distance.

SECRETS OF THE ADAMASTOR
29 OCT 3306

A private investigator has uncovered some background to the derelict megaship that recently arrived in this system.

Little is known about the Adamastor, which returned on autopilot after two hundred years with no sign of its crew. But an experienced detective has come out of retirement to tackle this mystery.

Local resident Benjamin Chester, who was a founding member of the renowned Wallglass Investigations Agency, told journalists:

"I convinced the Alliance Salvage Guild to pass on some serial numbers that they discovered inside the Adamastor. Then I started scouring databases, interviewing sources and, well, doing my old job."

"The megaship was owned by a corporation called Azimuth Biochemicals. This was taken over by a similar company called Pharmasapien, but both were liquidated long ago. No mission records exist, but service crew reports mention that the Adamastor's passengers included scientists, engineers and some kind of military."

"Eventually I unearthed a flight plan, logged in October 3111. It plotted a course toward Barnard's Loop with fuel for approximately 370 light years, and was scheduled to pass by the HIP 39748 and HIP 33386 systems."

"I'm way too old to head out there myself, but l hope someone can use this info, and help satisfy my curiosity about what happened all those years ago:'

Ship Log from Adamastor (Dangers Of The Sea). Credit to @Maestor_James for posting these screenshots.
The 1st Log System K class with 11 bodies and LP round number 3 is Synuefe XE-Y C17-7
Credit to @Mrrshal for the original upload.
SpookyPost.jpg

LP Data Download (there was a difference in English & French versions where 'WEST' had been translated to 'OUEST' but 'THE' not translated to 'LE' or 'LA' but seemed to be omission or oversight on French text only as Russian & German matched English version)..later changed back to WEST in French versions too.

8BFGTY4PLU67-RTYO06.45:GN63-74PHGJI E67-:F563-21-
574.9 ER34.6-DER8+WEST U.5 -RTG10 RTH8-4 6T.WR4564-
21 +G134.2 RT55.4 GDW THE42.1LY 764.2Y-45TG4.BTJ-Y.
6ORT437.1D341-67.Y5DS 243 45TY-3234
The 2nd Log System about M class star refers to Musca Dark Region PJ-P B6-1 Planet A 3 where a new base has been discovered - Geological Survey 23B, scanning the logs gives 4 messages, 3 dated and one not:
Credit to @Jmanis for finding the base and uploading all 4 Logs
1603979460077.png


1603979505398.png


1603979519469.png
1603979555873.png


1603979570342.png


1603979592604.png
1603979613219.png


1603979630364.png
1603979408918.png


1603979421497.png
The 3rd Log System is HIP 69200 planet 1B. On the planet is a Crashed Ship, a Sidewinder with the logs.
Credit to @Ganaar for the originals.
1604325271297.png

1604325884749.png

1604325899627.png
[/SPOILER

See GalNet 8th April 3307 for origin of mystery and this thread for the discoveries in real time:


It starts with an unknown signal from a Listening Post (LP) discovered inside the Adamastor that suddenly became active, receiving and broadcasting a signal that was coded.

When dropping into the Adamastor instance from SuperCruise (SC) a message is received automatically in the player chat inbox from an unknown source called 'Salvation'. This gives the ship computer a code to crack the LP. (Credit to @Erei for original)

20210408160145_1.jpg

20210408160201_1.jpg


When scanning the LP this code is used automatically to reveal the message (Credit to @Erei for original):

20210408180935_1.jpg

20210408180937_1.jpg


Which gives 3 'Keys' to use on another message from another 3 LPs. 'H1: -e, H2: +h, H3: -c'.

'Region: Taurus' leads us to the Taurus Dark Region. The first LP was found by @Rudi Raumkraut in 'TAURUS DARK REGION UY-R b4-0'

https://i.Please use another image host/ufZTiet.jpg

It contains H2 & H3 coded message, H1 is missing full text. By using the 'H3 Key: -c' from original LP (using c as third letter in alphabet meaning 3 or minus 3) this translates to columns 3 letters across to decode the H3 message. This was first discovered and decoded by @Ian Doncaster:

Original from LP:

H1 Key -E
H2 FBJILYIFUILOMPDYAFRGMKIULIN 1333 +H
H3 ADFFGDKIOOPLFNIHLRFEUOPQJWLSEDM -C

H3 now reads:

ADF
FGD
KIO
OPL
FNI
HLR
FEU
OPQ
JWL
SED
M

Using the H3: -c again to mean -3 or ROTATION -3 (which also equals ROT23) this now translates to

XAC
CDA
HFL
LMI
CKF
EIO
CBR
LMN
GTI
PBA
J

Reading the 3rd Column gives 'California' which is a nebula.

Applying the same logic, this bit first discovered by @Redden Alt-Mer, but using +8 to make a grid 8 letters across and using ROT 8 ('Key 2: +H' = 8th letter of the alphabet = 8) to the H2 bit of the message also gives:

NJRQTGQN
CQTWUXLG
INZOUSQC
TQV 1333

Reading the 8th column gives NGC3, but also using all the numbers gives NGC 1333 which is a Nebula.

The second LP was found by @Peter_Quill in 'PERSEUS DARK REGION LN-K B8-0'

1617973463014.png


Applying the H1: -e (e = 5) to make a row 5 letters across:

ACGTY
MNGYF
UIPLZ
GHUIW
BLUIZ
OPKMX
GTR

Using Rot 5 gives

VXBOT
HIBTA
PDKGU
BCPDR
WGPDU
JKFHS
BOM

Reading the 5th Column gives 'TAURUS'

So we now have TAURUS, CALIFORNIA and NGC 3 (NGC 1333) as the 3 points of the triangle and one last LP which had originally been 'harder to find but now made it easier' according to Zac from Frontier on Canonn Discord Group. It was found within 30 minutes by Cmdr Disgo around the Star in 'CALIFORNIA SECTOR IH-V C2-1' system.



https://i.Please use another image host/exRNnd4.jpg

The G3: code was later corrected from -D to +E at the end of the row by Zac on Canonn Discord Group and later in game. Credit to @Gremorius for the original updated version:


1618089374576.png


We now have 3 coded entries:

A1:-AX_,C2:*-A,G3:+E_
A2:/B,C1:+L_,G1:+F_
A3:-L_,C3:+AF_,G2:*-A

OR

A1:-AX_
A2:/B,
A3:-L_,
C1:+L_,
C2:*-A,
C3:+AF_
G1:+F_
G2:*-A
G3:-D_

OR

1618056889681.png


This is a code using Base 26. Where the letters are replaced by their numerical place in the alphabet A=1, B=2 etc and AX=50, BL=64 and _=10. The rest is maths:

A = -50_ /2 -12_ = -37_
C = +64_ *-1 +32_ = -32_
G = +110_ *-1 +5_ = -105_

A: -370
C: -320
G: -1050

Which are Galactic Coordinates that lead to: 'PERSEUS DARK REGION KC-V C2-2' . Here a megaship can be found in asteroid belt cluster 1around the B star, credit to @HuggyFace forthe original:

20210410174209_1.jpg


Scanning the Hesperus logs (credit to @CMDR Lego for the original)

1618091369753.png


And credit to @Yuzral for this second message found when scanning the logs:


1618091717991.png



There is also a scavenger / salvage megaship called the Dredge run a group called Scriveners who's logs and messages appear here:


And full text thanks to @Lucian Arkright for original:

SCRIVENERS CLAN - UPLOAD LOG 1/4
Knowledge Core Input VF-77655657
Status: Fail
Manual Intervention required.
Datagrapher Authell’s report:Most files from the megaship’s computer we uploaded without error but this defied our archiving process. Upon further inspection I found it to be encoded with a customised algorithm.
File Contents:
Timestamp: 12/07/3113 21:05
---
oadbedba---Temcnigrgoe-y-.Ensil-ui-etseianhtK-em-leede,nuptu..tc
g-.s-aniceyhtiih--ynocfet-raH-re.sel-psuh-ea-eerrot-t-ophtvbt-hs
-ehah-pi-stynereko-nevatb-e.nes-dmeeiylosr-eoMfohts-e-t-rc-aa-ie
eer-r-htedw-o--nd-rniiih,gdPki.sl-e'tu---slsrapanam-.seiaHhdot-.
eb--yehTah--Isregeenepa-st-ibn,dnaolcri-duow-g-e-osymmfoo-nht-sp
Horwoo-.t-n-h-d--Iehtldiyeesovuocdieh--rkcaeT-m-tehh-ysuva?lebaw
inegn-tia--tt-t-eih-,smiubltott-yadj-yehsu-...ne-o-ifpdeer.ouCwo
m-tsod-n-t-ts-ir-ceifuytsrfoi-dugcnM-Inija,hU-,uhamnert-t-rTb-eg
rirwedc--.er-e-trer-esewamhaehtnt-dehi-oc-cnogdiah--to-sugruiol-
atn-n.-nohpl-,-ynhtrteoclor.-dH-phtreesesuecP-taVirlev-esa--a--l
ndnga-amdeo--oehaagobt-rtutela-fe-fs-ohticheecmaat-dne-,w-n-amti
oedt--t-eh--tfigee-irnengnabvew-hleuosti-tl'niope-g.dsttl-e--eba
didt-selehv-nes-tos-eriuoss-eh-lv'y-elahottnaef--crsuhroi-ssep,n
hsrciow--h-fuoubudl-s--y-ah--wsr-oh'lu-.evepuoP-rhgamtahasf-necr
am-ireneseiafe-.frolienlrtbpoi-se-nriihts-thicytblatui-,t-es-sht
bsigi--eegiyo-tanept-roieht.evreue-llvp-de'enU.s-elams..by--htma
t-eihs-egn--padeoept-nt-ehhsadot-amaMs?rekA'es-.-snhtefiye-ea-kc
--ttieadehtdit-o-ueh-sm-rsurm-gspphsori-,ixnlysnss-w-erouoich-a-
ovaametuitdtllnea-yd-s-tsia-Asegil-st-san-orsmi-hturahP-amz-ipum
-nenk-tswoasobuoptuor--reba-hta--neht,dnta-sehuo--yisfdnngttfohn
an--nomura-taf-.dtct-snAahekemt-ynal'seh-l-elloy-a-otneng-i.t-eh
f-orit-mtstsT-csnehit-eits-wraksg-em-ani-e-stauons'xe--r-thypeah
s-.e-T'tsatB--usiewev-vr-.---tno--lahdt'evu-c-h-.ulH-ewowoaenaas
-l-ht-evsec-ep?elponalB--k-

SCRIVENERS CLAN - UPLOAD LOG 2/4
Knowledge Core input VF-77655658
Status: FAIL
Manual intervention required.
Datagrapher Authell's report: This is the second file that has resisted automatic processing due to its coded structure. The encryption resembles that of file VF-77655657, sugesting a common source. I am passing both files to Lector-General Calligore's department for further analysis.
File contents:
Timestamp: 13/07/3113 02:32
---
eadhbbea---eeiaeLnunKmttel-m,nryeg-ecoeel-nn,lrg-
far-ei.yn-'ea
dWnvmeoaet-g-omr--ovadduenuneet-sefcd-
eotverolarwrs-uoa-h-,nght-
eliohfstule--ilhi-ekthi-e-psed-tTseer--dseh.-raohclgh--
dodasenus
ph-dd-poroeft-eidlsirehomt-nwer-dec,eleo-h-ue-rrua-
tio-shsthnni-
urtggo-hihgroehrsti-rrbdc-,od-tetunsd-yluehywlani-tleu.-
-teqPiDa
a-rdhsem-ipam..--nG.y,oo-htdy-ehhsopct-ps!saaeWel---
vp-ahna-m-o-
.tsjppehuV-i-saallschot-onuv-reo-e-etepudxesesocelhi-
gtav-srac-e
io-rtdraets-ntc-eawi,l-hol-ieaeeelrdvnoy-t-olhtub-nea-
sc-yahel-o
e.r'-rhdv-de--re-ejtrn-oosuiodn--ab-tareneh-c-.nfo'laart-
of-lt-s
rdeooe----.hhehv-Teyatnn-am'teg-kabdocyl-m-oaocde--
mndycm-soo,tl
be'---als-eloelgube--f-ttll-ono-lcotlatfr-l-c-en-
hdsoypaexeriron
fl-aoa-ct.tr-f-f-A-eoeitwcshttn--ehiselasipv-
itxeopneieegcnrtf-n
y,aoulStr-efemteoh--neoevm-awot--ntnuctnio-t-
ineshmosse-,i-iyh
aaent--rgeremsy-iswtshrie-nttgnayatehao--c-m-atlaniia-
eentrn.caL
-fet-setses'efigu-e--oatw-t-fvir-lsei-mt-'l.gogtc-oi-np-
nyrest--
-tlhes-oenigeehtctr-n-pacmol-etoru-rsasP,amh-
ipodanew-e'ntete-t.
-c-tmtiBhzAuwtulnmlhiaa,--d-sl--'ttety-
hallewonapktwhan--eph-.ds
nes.aitu.-gmvyerah--en-meegat-oketerahe-eH-tsep-
ksbr.n-lu--a


SCRIVENERS CLAN - UPLOAD LOG 3/4
Knowledge Core input VF-77655770
Status: FAIL
Manual intervention required.
Datagrapher Biblian's report: This file was flagged due to its encrypted nature. Cross-referencing has found two similar instances (ref VF-77655657 and VF-77655658), but their encryption keys do not match. Research-Sergeant Indesh obtained this file from the internal drive of an empty EVA suit.
File contents:
Timestamp: 22/07/3113 09:40
---
bbaadcddmidjbgdfebldbbflnacifdcddndgjdfebbhkgbchbea
fddfjebdbggbd
dggbbhnaffcdgicjcbbmcddldeebejjcalbfafchfcfcajdcahnec
dcecchbcifc
jcajcdcagiegeabkakagjbhgbchbbgcjbehchgfejagjdhadegbf
ockibdfeedbe
cgbdgeldcfehcbddfhccmdnleackdebbgoceigdb
-cdb
.dsna-ikltuexn.teonot..teyhre'rse-
T.urmerdsnetioheT'rytoh.tollim
e-n'onktheTiwyal-.slhat'stveo,ertockaoptreyhsalteftianao-
oserpsp
eruethknHeakoepeonlltgeatbamt-
hyembrhugotonlynsaaiepPh-rmaetmath
lrlhetll'teaemh-l.eltetll'slelhasl.lthTt'aneir,en-
angeju.tdsteu
mlm.arBoreelngownwhiade-kytehlraybeigme.mTh-
ratkdclasdunoctmmoyh
muisinso-tpadchtnteeyhnaiasclo-
,tgxteisheneodchosldup?ilt-ireshs
ngithirehaktttsemhs-lhitaro?ndkicnbootgba-
thsyeecH.veascepeadaeo
ptmasagn-chewrziAutmktfenhomsaoeknlwbolye-
l?beiatreeneldishdohwa
t-tsita...e!seWrneoela-semeoetssboreehaeg.nThhloTkioto-
go.dhlvea
tei.edisrsuoneeselangonynlusseivl,ieefl-ateoybne-
hnlodbtlteumlg
hiaio.hrnsihettisl-labbydlsn'ropenhitaga-
ttsoiponssxiseilftth-so
tf.fyimuiskiaghnisrttkanCt-'..dni.-
fdunockoanseaerlighuthcatkroh
epmacbs.mCasl-lomcosLkatech.nkattlconteoubo-
sewlgea,hdetramdysaw
e-reorrarsenseifath-
erdngideeonwstsrtacheefi.hrheTngifoT-leokoy.
eerwaththdatcewendalorotoynratdgtathusi'-
Agimzeu,insgnilsamaubsn
-nrnhongifodeaschrbelnueWeove'huhl.lnsohet-
ostdunl.waawa-..sl!lt
lxheteamllidteg'n-ksmeohitodGsS.hioyhml.l.t.thu-
asndamoneyis-eth
sireewrthicfeoolonathplysngeiyhre'eds-
T..kdasGisoneo..enp.ervoney
unoaedanlbfd-seiphtontheacbhikcote-
mejestu.rl'vl'NOileneiraer-on
gEeJsniuhitsiss.i.e.thhsTingi...ecRrdo

Log Four:
Knowledge Core Input VF-77655771
Timestamp: 22/07/3113 13:08
---
daacbaabdgbebbhaeibbfcdbkeefdcdcbgjacbhifafebhlekfidclfbhjfaefhe
bdgbadkbckehfefgadhddkhdcffoafalkddoedckadfdaeakllaicjabrdadedgd
fdhcjganbcebbicldadgdgjcaigficoaafldgdcgfjbcdefhealgdbjbmebghf
-cdb
o?dT-.dodleroWnathgnow?ooid-dlwhetba-lo...Hodldwheue?raytinonhas
slonl-cgdH?wnoamwnyautbho-nka,tsarpxteavhese.tre-Wonsaiighnowlru
tninuis'st-n.yiM-th..oensugoldubeehstwocabwearpatfesd-nusjreeka,
ervwhyinrnegliagenicmlsaelshecfbohetkecs-tbeepohreell'p.iThtreis
h-eehnteatnrtentomiata'ecdl-eanc,snutblelowdhithasteTR-aco.ldue.
mdlerbetouervonyf.lnEgheiserudlngi.-gncletginhlivinvev-ryeddeuto
.ltipWdiuoidwhohest'ashs.-kThdetnorwtiannoenviltatoe-hdtentigxni
pp.e.eibhitk.nd,llt-geahosis'orttintsshseiecomrtht'ry-fe.n.hetOX
TC.lrkadienka-mscaistleceemheesthcacinpaghi.stwa-krsAnnaldsoss.r
prlceohepicratbosmimrryath-eperohghuhigttteefind--eyrbmettsnomca
rpviiganth-eleostllaegdshaveafeTulo-hdone.cewdoomsseiehdrrlaletr
n.oeolrcengctntoupsorpliie-fneihetbl-md'oabd.relnnuoveeyorllidoe
shhske.-dndAbedinhnlnfteeaveebstuha-Shtxmesca'.oe'selVetgaysD-la
dborf,smyitniuecsriungiath-wsarenS.e'hthorseitle-hkeialsneoeldcp
,isotahownypdigrerhbosg-ntkalonkio.as'mldlihitmaobdnon-ewestu...
t'ihjsacb,tkco-eemidd'tncrrwaegiialnheTor-nee.edshtppateuhawunoh
od'vlTfe

The words are chopped up and put back in the wrong order. In the third log we can see Azimuth & Pharmaspien, look for capital P & A.

Log 3 & 4 were solved by @hangfireflip then Log 1 by @Ian Doncaster (with some typos from original message corrected here where possible) and finally Log 2 by Canonn

Log 1:
This is lieutenant Kelemen, deputy... acting security chief on the Hesperus. l have to report that the ship has been overtaken by enemy soldiers. Most of the crew are either dead or in hiding, like us. lt's Pharmasapien. Has to be. They had sIeeper agents onboard, including some of my own trooas. How the hell did they avoid our checks? They must have been waiting all this time, but today they just... opened fire. Cut down most of security first, including Major Umaru, then the bridge crew. The rest were marched into the cargo holds at gunpoint. In an hour, they controlled the Hesperus. Private Velasco and l managed to gather about half of the science team, and we made it to the aft engineering levels without being spotted. I've disabled the sensor suite so they'll have to search for us in person, which should buy us a few hours. I've fought Pharmasapien mercenaries before. infiltration is their speciality, but this is the biggest operation they've ever pulled. Unless... maybe the same thing happened to the Adamastor? Makes sense. If they attacked either them or us using ships, proximity sensors wound have automatically sent a distress signal to Azimuth. Pharmarapien must know about our probes then, and that they found signs of nonhuman artefacts. And that means they'll kill anyone to get to them first. The scientists are asking me what's our next step. That's easy we survive. But l don't have a clue how. How can l save these people? Blank

Log 2:
Lieutenant Kelemen, emergency log, final entry. We've managed to move around undetected for several hours now, although it feels like the ship is deserted. The cargo holds had hundreds of people imprisoned there, we could hear their shouts ringing through the corridors, but suddenly they all went quiet. Did Pharmasapien... my God, those psychopaths! We have a plan to jump ship. Velasco has volunteered to use explosive charges to create a distraction, while l lead everyone to the launch bays. l've ordered her to rejoin us and not be a hero. l can't afford to lose her. They haven't managed to block my command codes yet, so l'll be able to get full control of all the secondary exploration craft. A few of the scientists have piloting experience, fortunately. Some of them even want to continue the mission, saying there are systems within range that may contain alien artefacts. Let's see if we get out alive first. l'm going to encrypt these logs in the central computer, so Pharmasapien won't detect them. But Azimuth will, and at least they'll know what happened... assuming they ever manage to retake the Hesperus. blank

Log 3:
Recording ... this is... this is Junior Engineer O'Neill. I've just come back into the ship and found everyone... poisoned. Gassed. They're lying on the floor with their eyes and mouths all... on my God. Something's killed them all! I was... I was out on the hull. We've been searching for nonhuman signals, using Azimuth's data to try and locate what they were looking for. The chief started wondering if the sensor arrays were damaged, so I went out to check. Lost all comms. Came back through the airlock and found... Can't risk taking my suit off. If this is poison gas then it's probably still in the air. I might be the only one left alive, unless anyone else is suited. I have to go looking. There has to be someone else! Wait... was this done deliberately? I know some of the Azimuth crew managed to escape. Have they got back onboard? is this them retaking their ship? I should encode this log, in case they patch into my suit comms and track me. They might already know where I am. But I'm just an engineer, that's all. I'll tell them. I'll tell them that Pharmaspien only brought my team along to keep the Hesperus operational after they took over, that's all. They won't kill me too. They're not murderers. They're not... not like us.

Log 4:
I've found out what happened. The original crew didn't come back, it's just... One woman did this. I'm looking at her body right now, poisoned like all the others. She's wearing a security uniform, ID badge says "Velasco". She must have been left behind. And she killed everyone on board. I'm in the life support control centre. I realised how someone could have fed gas to all the living compartments by feeding it through the primary atmospheric processors. And I was right. I can see the chemical tanks marked TOXIC... they're from the scientists' storage hold, I think... being piped into the ventilation network. That's how she did it. Wiped out every living thing. Including herself. Everyone but me. I could teaR (this is how it decoded) this all down, but I can't decontaminate the entire ship. There'll be pockets of these chemicals lingering everywhere, and just a few breaths would be enough to ... My suit's running low on air. We have spare tanks, but how many? How long can i stay in here? How do I... what do I do now? What do i do?
Last edited: Today at 12:14 PM

Twitter: Apr 19th:

//FEED INTERRUPTED //INCOMING TRANSMISSION
Commander, Have you listened to the truth that the Hesperus has to tell you? We don't have long. -SALVATION
//FEED RESTORED

1618868002330.png
 
Last edited:
Private investigators Erik Gunnarson and Francesca Wolfe review the Neo-Marlinist Liberation Army.

Gunnarson: “We don’t usually get involved with political cases, but it’s hard to ignore the largest terrorist attack in history.”

“The NMLA is a radical offshoot of Marlinism, a democratic movement named after the Republic of Achenar’s original ruler, Marlin Duval. Most are peaceful protester types, but Neo-Marlinists want to overthrow the government by permanently removing the Imperial Family.”

“What nobody knows is how the NMLA went from minor troublemakers to interstellar terrorists. The starport bombings last September came from nowhere, and their assassins have killed many Imperial bigwigs including Prince Harold Duval.”

“Smart money was on them being funded by Empire’s enemies, but now the NMLA treat the Alliance and Federation as equal targets. Hitting all three superpower capitals was a hugely symbolic gesture, and should have been impossible. How did they bypass security and plant explosives without detection? Who the hell are these people?”

“Even Wallglass doesn’t have a clue. But we won’t stop searching.”

Wolfe: “Despite my enquiries – and some unauthorised snooping – there’s no trace of the rumoured NMLA bomb factory in LTT 1935. But it did once exist, because the Empire captured its occupants.”

“Not that they’ll admit it. ‘There is no such place as Serene Harbour’, right? Well, I’ve been to R CrA Sector AF-A d42 3b and seen it myself. It’s bleak. Hope-crushing. And yet the NMLA prisoners listed as Theta Group escaped, broken out by what seems like Imperial Intelligence double-agents.”

“That genuinely scares me. If the NMLA can worm inside the most shadowy security organisation in known space, they could be anywhere. And none of us are safe.”

The Affiliated Counter-Terrorism unit (ACT), formed by all three superpowers to combat the NMLA, has launched its investigation.

The organisation has been working closely with Alliance Interpol, the Imperial Internal Security Service and the Federal Intelligence Agency to collate data on the terrorist strikes against nine starports.

Captain Niamh Seutonia, one of ACT’s joint leaders, told the media:

“Initial forensic results from the targeted stations suggest the use of a more compact bomb design than in previous attacks, possibly constructed on-site. Worryingly, the NMLA’s new generation of weapons seem to be easier to transport and conceal.”

“The good news is that a comparison of reports has revealed one very promising lead. I will personally take a team to follow this up, and we’re hoping for an early breakthrough.”

Inspector Mara Klatt also provided a brief progress report:

“Our working theory is that the NMLA employs an undetectable interstellar communications system to coordinate its attacks. A similar dark-comms network was used by the League of Reparation before we decrypted it, but this version is evidently more sophisticated. We are liaising with local security services to gather evidence.”

The Marlinist Parliament has refuted widespread allegations of supporting or concealing members of the NMLA paramilitary group.

Fuelled by media speculation, many political and military leaders have suggested that the Marlinist Colonies should be occupied or destroyed to take revenge for the recent bombings. However, there is no evidence that these systems have any direct connection to the NMLA.

First Minister Jenna Fairfax gave this statement to Vox Galactica:

“The starport attacks were as sickening and terrifying to us as to the rest of the galaxy. The Neo-Marlinist Liberation Army follows a twisted creed that has no bearing on true Marlinism.”

“We have sent our own intelligence team to join ACT, led by Captain Milo Castile of the Marlinist Constabulary. It is vital that we all work together to end the NMLA’s campaign of terror.”

There was also a comment from fellow parliamentarian Aaron Whyte:

“I understand it’s human nature to seek a villain, but we should remember that the Neo-Marlinist cause has sound political foundations. The Empire suppressed all republican movements for centuries, imprisoning and executing far more people than those who died in the ‘Nine Martyrs’.”

President Zachary Hudson has announced that the new vice president of the Federation is Jerome Archer, replacing the deceased Brad Mitchell.

Archer was previously serving as the Secretary of Security. Prior to becoming a congressman, he was a director of the Federal Intelligence Agency and had a long career in law enforcement.

His predecessor, VP Brad Mitchell, died in the NMLA bombing of Li Qing Jao station in the Sol system. The attack also killed several members of the Federal Cabinet along with many government officials, who were attending a meeting at the starport.

Addressing a gathering of Congress, Vice President Archer said:

“My primary focus in this office will be to increase security throughout the Federation. I vow to build vigilance into the fabric of our society, and prevent such atrocities from ever happening again.”

During the congressional session, President Hudson announced new appointments for other deceased members of the Cabinet. He also successfully obtained approval to increase funding for counter-terrorism operations run by ACT and the Federal Navy.

Pilots Federation ALERT

Assistance is needed to track down an ACT operative who vanished while on a mission to identify NMLA suppliers.

The missing agent is Captain Niamh Seutonia of the Imperial Internal Security Service, one of the joint leaders of the anti-NMLA intelligence unit. She was following up on clues resulting from analysis of the ‘Nine Martyrs’ starport bombings.

Senior Agent Tanya Ramirez, a co-leader of ACT, gave this statement:

“Captain Seutonia and her team were travelling on an Anaconda-class vessel named the Valkyrie. Mission details are scarce as information was compartmentalised for security, but she was investigating a minor faction that may be supplying the NMLA.”

“We know that her ship left the Mudhrid system on the 24th of March, on a heading toward the Marlinist Colonies. Captain Castile of the Marlinist Constabulary, on secondment to ACT, arranged a rendezvous that she never reached. So we know the Valkyrie went missing somewhere inbetween.”

“All Commanders in the region are asked to join the search for Captain Seutonia’s ship. Our fervent hope is that we find its crew alive, and that they managed to obtain data to help us defeat the NMLA.”

Pilots Federation ALERT

Safeguard Interstellar has successfully received medical supplies for civilians wounded during the NMLA terrorist attack.

The bombing of nine starports across the Alliance, Empire and Federation left huge numbers of people injured, some with caustic burns due to Thargoid enzymes deployed by the explosives.

Noel Beaumont, the aid organisation’s CEO, announced:

“We are immensely grateful to all pilots who brought shipments of basic medicines and advanced medicines. These have been transported directly to the relevant systems, where they will be used to ease the suffering of several hundred thousand civilians.”

Safeguard Interstellar confirmed that its partner factions have made rewards available at the three systems used as staging areas for deliveries.

Pilots can collect from the Perez Ring Brewery at Krylov Ring in the He Bo system, Lavigny's Legion at Mackenzie Relay in the Cemiess system, and the Duamta Gold Creative Corp at Davis Terminal in the Duamta system.

Over the past two weeks, emergency services have been concentrated on the nine damaged starports in the Achenar, Alioth, Eotienses, Gateway, Kamadhenu, Lave, Nanomam, Rhea and Sol systems. All survivors have been accounted for and repairs are largely completed, mainly due to dedicated support by members of the Pilots Federation.

Former President Jasmina Halsey has joined the Federal Diplomatic Corps to become an ambassador to the Alliance.

In recent years Halsey served as an advisor to Prime Minister Mahon, but returned to the Federation in January to stand as a witness in the Starship One trial. She was a guest of Shadow President Felicia Winters at the Galactic Summit, and both were evacuated back to Mars when it was cancelled.

At a press conference, Ambassador Halsey said:

“Being at the conference reminded me that the political arena is where I belong. My new responsibilities allow me to continue serving the Federation while making use of my experience within the Alliance, and hopefully build stronger bridges between the two.”

Elijah Beck, head of the Alliance Office of Diplomatic Relations, sent this message:

“Jasmina’s level-headed advice has calmed many tense political situations. This is the ideal role for a diplomat of her calibre, and I look forward to working with her again.”

In related news, the Federal Diplomatic Corps confirmed that Ambassador Jordan Rochester had been recalled from duty to be reassigned. Most of the Empire and Federation’s embassies in each other’s space have been closed since November 3306.

The fear of further starport bombings has placed internal and external pressure on the Empire to address the threat posed by the NMLA.

Despite sharing intelligence via ACT, the Alliance and Federation have demanded that the Empire must do more to eradicate the NMLA, since it is ‘Imperial in origin and ambition’.

The latest developments were covered by mainstream media channels.

The Imperial Herald: “In the Senate, Chancellor Anders Blaine reported that the Emperor has instructed him to present a range of options. Senator Lorcan Scordato has volunteered to visit the Marlinist Colonies on a fact-finding mission, to better understand the political character of the Neo-Marlinist fringe.”

Eye on Achenar: “The entire system is still shellshocked by the slaughter at Dawes Hub, a vicious stab at the heart of our glorious Empire. In our opinion poll, 93% of right-thinking citizens would send a fleet of Majestics to the murdering Marlinists instead of some soft-hearted senator.”

Vox Galactica: “In most Imperial cities and settlements, anxiety levels remain high. The NMLA’s ability to strike seemingly anywhere has rocked public confidence in the Empire’s strength. Opinions on Marlinism itself are more polarised than ever, with accusations of ‘warmonger’ and ‘collaborator’ dividing many families and relationships.

Vice President Jerome Archer has successfully proposed a new public surveillance law designed to prevent future terrorist attacks in the Federation.

The Domestic Counter-Terrorism Act was debated in Congress before being approved by a majority vote. It is considered to be emergency legislation that replaces all previous laws regarding monitoring civilian activity and intercepting personal communications.

Vice President Archer, who personally drafted much of the new statute, announced:

“This will allow the government to actively seek out any terrorist agents and sympathisers lurking within our communities. We will never again allow so many families and friends to be taken from us.”

Shadow President Felicia Winters responded:

“Nobody wants another ‘Nine Martyrs’, and it’s vital that security is increased across the Federation. But this is an outrageous violation of civil liberties. For this administration to grant itself access to every citizen’s private life makes it resemble a dictatorial regime.”

VP Archer later confirmed that he is already working with the heads of security services on practical applications of the new law. As a former director of the Federal Intelligence Agency, he is expected to make rapid progress.

Pilots Federation ALERT

The vessel of Captain Niamh Seutonia, who vanished on an anti-NMLA mission, has been found with its crew dead.

Following a widespread search by independent pilots, Commander TheRealFlame was the first to discover the wreckage of the Valkyrie in the Trianguli sector GW-W B1-0 system. It was apparent that the ship crashed after sustaining weapons fire, and that all crewmembers died on impact.

ACT co-leader Senior Agent Tanya Ramirez gave this statement to the media:

“We owe a debt to every pilot who joined our efforts to find the Valkyrie. It’s an emotional blow for us to lose one of ACT’s guiding lights, along with her courageous team.”

“However, Captain Seutonia managed to secure her mission logs moments before the ship’s destruction. This allowed vital information to be recovered.”

“We now have evidence confirming that a Neo-Marlinist faction in the Mudhrid system was directly involved in the NMLA starport bombings. We have shared our findings with Imperial authorities, and the Order of Mudhrid is being investigated.”

Captain Niamh Seutonia rose to prominence as part of the tri-superpower taskforce that eliminated the League of Reparation in 3304. The Imperial Internal Security Service confirmed that she will be posthumously awarded the Achenar Service Cross

Pilots Federation ALERT

Conflict has erupted between the Epsilon Fornacis Empire Group and the Neo-Marlinist Order of Mudhrid.

An investigation by ACT in the Mudhrid system confirmed that the Order of Mudhrid provided logistical support for the NMLA’s starport attacks. Their agents infiltrated other local factions to transport enzyme bombs to their targets.

The faction has now renamed itself the Neo-Marlinist Order of Mudhrid. Landgrave Arastin Delacroix, its leader, has declared a revolution against the Imperial Family. From his flagship, the Steel Majesty, he announced:

“The corrupt Duvals will never give up their power, so we must take it from them. All those who seek to change the established order – join us!”

The Epsilon Fornacis Empire Group responded by engaging their forces in battle. Senator Denton Patreus has ordered them to “take revenge for the ‘Nine Martyrs’ atrocities.”

This is the first instance of a faction openly adopting Neo-Marlinism, although it has not been officially recognised by the Marlinist Colonies. Minister Aaron Whyte commented:

“It’s a lost opportunity that Landgrave Delacroix chose to aid extremists, rather than provide a political platform to the Neo-Marlinist community. I hope we can soon replace the cycle of violence with meaningful communication.”

Erik Gunnarson and Francesca Wolfe investigate the abandoned relics of spacefaring communities from the early years of colonisation.

Wolfe: “Generation ships are essentially mobile cities designed to carry expanding populations, and are always an impressive sight. But there’s one I keep returning to – the Thetis, orbiting Nefertem 6 a.”

“Listening to its logs always chills my blood. They describe how a whispered phrase from an uninhabited planet somehow caused over 17,000 people to slaughter each other. Nobody knows if it was mass hysteria, psychological stress from decades in space, or… something else.”

“So many visits to the Thetis, and I still can’t work up the nerve to play its final log entry. I’ve been warned that I won’t be the same afterwards.”

Gunnarson: “Before hyperdrives, generation ships were a viable way to colonise distant star systems. Millions of people lived out their whole lives within self-contained societies, so their descendants might walk upon new worlds.”

“The tragedy is that many of these pioneering megaships vanished entirely, never reaching their destinations. But some were rediscovered, usually because of listening posts intercepting their ancient broadcasts.”

“There are various reasons why these expeditions failed. The Lazarus, now orbiting Virudnir 6, suffered mechanical breakdowns whereas the Pleione, in the Hez Ur system, had a population that only produced male babies.”

“Most disturbing are those where the crew descended into barbarism, like the Artemis at Mu Cassiopeia C 1 and the Demeter in the Mizuchi system. Along with Wolfe’s favourite – if that’s the right word – these stand as horrific monuments to our darker natures.”

“Lost generation ships rarely carry survivors, but that was the case with the Golconda, whose people now occupy an outpost on Upaniklis B 3. So perhaps more living relics are still adrift in the void, waiting to complete centuries-long missions.”

Imperator Hadrian Augustus Duval, leader of the isolationist group Nova Imperium, has married his consort Astrid Minerva in a closed ceremony.

Commander Minerva was a young Imperial pilot who aided Nova Imperium at the Battle of Paresa in 3305 and became a loyal supporter. Her official title is now Lady Astrid Minerva-Duval.

Princess Aisling Duval personally attended her cousin’s wedding at a secure location. She referred to it as “a precious moment of joy in these bleak times”.

The Imperial Palace and the Senate have sent congratulatory messages, and the event was covered by mainstream media.

Paresa News Network: “Astrid’s well-deserved rise to nobility has made her fellow Paresans very proud. Everyone at PNN is overjoyed for the happy couple!”

Eye on Achenar: “It’s an insult to the noble Duval bloodline when some trigger-jockey from a gutter system can sink her claws into the Emperor’s own nephew.”

The Imperial Herald: “Hadrian taking a bride at the age of 20 has surprised many. If he becomes the only Duval to produce heirs, it will place pressure on Emperor Arissa and Princess Aisling, neither of whom have consorts.”

In related news, Nova Imperium vessels are participating in the current conflict against the Neo-Marlinists of Mudhrid. Praetor Leo Magnus, head of security, is liaising with the IISS on anti-terrorism intelligence.

The Proactive Detection Bureau has been set up by the Federal Intelligence Agency to scan civilian communications for signs of terrorist activity.

The new department was formed following congressional approval of the Domestic Counter-Terrorism Act. This was drafted by Vice President Jerome Archer, who told the media:

“The PDB is a vital tool to prevent further massacres on the scale we have recently witnessed. It will unearth NMLA terrorists and other dangerous activists concealed among innocent citizens, and help keep our families safe.”

Deputy Director Bethany Blake, who has been appointed to run the Proactive Detection Bureau, explained its operations:

“Highly advanced algorithms will scan all data transmitted across public and private networks on a system-wide level. Any suspicious communications are redirected to a regional hub, for review by trained investigators.”

“It is important to understand that only specific activity within narrow parameters will be flagged, and must pass dozens of automated checkpoints before our operatives can access it.”

Shadow President Winters and civil rights groups have protested that this violates long-standing privacy laws. However, President Hudson has championed the PDB as a cornerstone of the new counter-terrorism statutes.

Pilots Federation ALERT

The Mudhrid system conflict has ended with the Epsilon Fornacis Empire Group overcoming the Neo-Marlinist Order of Mudhrid.

This was triggered by ACT discovering that the Neo-Marlinist faction had provided transports and logistical support for the NMLA’s attacks against nine starports.

The Epsilon Fornacis Empire Group has thanked all pilots who contributed to its triumph. Rewards are now available at Payne-Scott City in the Mudhrid system.

Landgrave Arastin Delacroix, ruler of the Neo-Marlinist Order of Mudhrid, has so far evaded capture. He managed to broadcast this message:

“Those brave warriors who fought for our cause can receive recompense at the Steel Majesty. One day we will slay the Duvals and bring revolution to the Empire!”

Inspector Mara Klatt of ACT told the media:

“This is a definite victory against the NMLA. It also provides an insight into their modus operandi – promising disenfranchised or delusional leaders, such as Landgrave Delacroix, increased status in the new Republic should they succeed. We assume they used similar third parties to support the Alliance and Federation bombings.”

“Our agents are gathering information, but it’s clear that the NMLA’s network is more advanced and widespread than we first suspected.”

Pilots Federation ALERT

The Adamastor, a 200 year old ‘ghost ship’ in orbit around Chukchan 5 b, has received a mysterious encrypted signal. The derelict vessel has been undergoing investigation by Alliance Salvage Guild teams since its discovery last October. They released this report:

“Months ago, we cut open one of the Adamastor’s damaged cargo holds to find an undeployed communications beacon. We managed to power it up, but it contained no data and had never been used.”

“This beacon has now automatically activated, and is receiving and rebroadcasting a long-range signal. The transmission’s source cannot be identified, but is definitely of interstellar origin. Its encoded content has yet to be deciphered.”

The Adamastor vanished in 3111 after an incident that may have involved the first historical encounter with the Thargoids. It reappeared in 3306 when it entered the Chukchan system at sublight speeds on autopilot, with no sign of its crew.

It was recently learned that in 3113 the Adamastor’s sister ship, the Hesperus, also disappeared. Both were owned by a corporation called Azimuth Biochemicals, which was absorbed by a rival named Pharmasapien. Little is known about either company, but it is believed they were competitors in the field of xenological research.

Senator Lorcan Scordato has visited the Marlinist Colonies on a fact-finding mission as part of the Empire’s anti-terrorism operations.

The Imperial Herald was permitted to publish this summary of his preliminary report:

“Considering their recent refugee status, the Marlinist communities are remarkably well-organised. Their government works along republican lines but they have not abandoned Imperial culture, with many feeling homesick for their original worlds.”

“However, their situation remains precarious, with three of their eight systems now under the control of external factions. Without increased support from the galactic community, further losses may be unavoidable.”

“Regarding the NMLA, there is widespread anger that they have made all Marlinists look like monsters. Only rarely did I sense guarded approval, with the vast majority openly condemning the terrorists.”

“The Marlinist Parliament is small but efficient, containing a spectrum of viewpoints. First Minister Fairfax is focused on cohesion and survival, Amrita Ross discussed future reintegration with the Empire, while Aaron Whyte sees Neo-Marlinism as a valid political movement if violence can be avoided.”

“Months ago these were ordinary Imperial citizens, and our shared history still binds us. Generally, I feel that the Marlinist Colonies are closer to allies than enemies in our war against the NMLA.”

Erik Gunnarson of the Wallglass Investigations Agency discusses the nomadic tribes that wander the galaxy in converted dredger megaships.

“It’s well known that there are many travelling communities – groups of people who prefer to live on the move rather than settle anywhere. Proudly independent, they survive on the fringes of civilisation and tend to avoid interacting with the authorities. Those commonly known as the Dredger Clans are among the most successful.”

“Dredger-class bulk cruisers convert both natural and man-made minerals into raw resources, to sustain themselves on deep-space voyages. Improved hyperdrives and fuel-scooping systems made this design redundant long ago, but some were taken over by nomads and kept operational.”

“These dredgers are now a type of generation ship. Each hosts tens of thousands of people, whose cultures have evolved – or devolved – over decades or centuries. Some are true loners while others have formed alliances, or occasionally gather to increase their gene pools.”

“Typically these clans act as scavengers, quickly passing through systems to steal anything not locked down. Several take what they need in more aggressive ways, such as raiding unprotected outposts.”

“A few have even darker reputations. I remember being told as a boy: ‘If you don’t behave, the Phagos take you away in your sleep and eat you up.’ All my childhood nightmares came surging back when I discovered there may be some truth to that story.”

“More recently, I’ve heard rumours that a rarely seen Dredger Clan has resurfaced. Naturally, Wolfe has rushed off to find out more. Hopefully she’ll be able to increase our limited knowledge of these mysterious tribes.”

There have been mixed responses to the Proactive Detection Bureau, which monitors private communications in the Federation for terrorist activity.

Mainstream newsfeeds reported on the situation:

The Federal Times: “Civil rights groups are united in protest against the PDB. The controversy was also seized upon by the corporatist movement that was formed by Jupiter Division supporters. Their spokesperson stated: ‘The government has overstepped its authority and must be replaced by direct corporate rule.’”

Sol Today: “Has everyone already forgotten Li Qing Jao station burning in the night skies above Earth? Whatever it takes to keep us safe must be done. Only people with something to hide demand secrecy.”

Vox Galactica: “Professor Irene Ralston of Olympus Village University told us that her political history students received visits by FIA agents for researching Marlinism, despite it being on the curriculum.”

The Tau Ceti Journal: “Corporations that incurred financial losses in the bombings have welcomed the PDB. But other businesses have submitted legal challenges, claiming a right to protect sensitive commercial information. Megacorps such as Caine Massey and Vandermeer are even threatening to withdraw political donations.”

15 APR 3307
Pilots Federation ALERT

The Kumo Crew syndicate has launched an initiative to construct up to five starports to stimulate galactic trade.

Kavanagh Spaceframes Ltd, an independent construction company, has been privately contracted by the Kumo Council to build fully operational Orbis stations. These will be located in uninhabited systems close to key trading regions and areas of commercial interest.

The Pegasi Sentinel newsfeed featured this statement from Archon Delaine:

“As sovereign ruler of the Kumo nation, it’s my responsibility to increase prosperity for the systems under my protection. My new starports will extend our reach and boost trading of all kinds… legitimate and otherwise.”

“I have also placed bounties on the heads of anyone who dares to interfere with my plans. The one thing we never trade in is mercy.”

The Razor Whips, one of Delaine’s loyal factions, is organising the campaign. It will reimburse pilots who deliver ceramic composites, semiconductors, polymers and water purifiers to Gabriel Enterprise in the Harma system.

The number of new starports will depend on the quantity of deliveries. The targeted locations are:

Pegasi sector PN-T C3-14, near the Harma system

HIP 18390, near the California Nebula

HIP 10792, near the Sothis system

HIP 62154, in the Coalsack Nebula

Eol Prou PC-K c9-91, in the Colonia region

Survivors from the Neo-Marlinist Order of Mudhrid have arrived in the Marlinist Colonies, requesting political asylum from the Empire.

The faction was recently defeated by Imperial forces in the Mudhrid system, after an ACT investigation confirmed that it provided logistical support for the NMLA attacks on starports.

Landgrave Delacroix and his loyalists fled aboard the Steel Majesty megaship to the Hyades Sector RO-P b6-2 system, which is controlled by the Marlinism Reformation Party. Minister Aaron Whyte, its elected leader, announced:

“Not every individual within the Neo-Marlinist Order of Mudhrid is an NMLA activist. We have the right to offer asylum to protect innocents from persecution, just as the Federation protected us when we were refugees.”

The Empire has officially demanded that the Neo-Marlinists be apprehended, with Senator Patreus claiming “The Landgrave of Mudhrid is a traitor and a war criminal.”

Both the Alliance and Federation have likewise insisted on their arrest. However, Shadow President Winters reminded Congress that the Marlinist Charter grants their systems the same legal powers of asylum as the Federation.

The Marlinist Parliament has declared an emergency situation. First Minister Fairfax called for a discussion of options, while Ministers Amrita Ross and Tamsin Taylor urged cooperation with the Empire.

Pilots Federation ALERT

Commanders have reported receiving anonymous instructions regarding the 200 year old derelict megaship orbiting Chukchan 5 b.

A communications beacon stored onboard the Adamastor began receiving and rebroadcasting an encrypted signal on the 8th of April. Efforts by authorities to trace and decipher the signal proved unsuccessful.

However, a number of independent pilots claim to have been contacted by an anonymous source, who provided an access key to decode the Adamastor signal.

Commander Rex Trevelyan gave this statement to Vox Galactica:

“Not long after arriving in the Chukchan system, my ship received a message from someone calling himself ‘Salvation’. He provided a decryption key, and when I downloaded the signal from the Adamastor it became readable. It seems to be an automatic SOS from its sister ship, the Hesperus.”

“I’ve heard that some Commanders have made sense of the navigational data in the signal. It feels like pilots are being recruited for something, but who exactly are we working for?”

The Pilots Federation has begun an inquiry into the situation. The identity of ‘Salvation’ remains unknown, but there are reports that the Adamastor signal contains data that has led to its sister ship.

The Neo-Marlinist Order of Mudhrid has been granted sanctuary in the Marlinist Colonies in return for revealing the identities of the NMLA’s leaders.

The faction’s survivors arrived in the Hyades Sector RO-P b6-2 system after being defeated by Imperial forces. The Marlinism Reformation Party agreed to offer political asylum, despite all three superpowers demanding the refugees’ arrest.

Imperial Senator Lorcan Scordato, who was visiting the Colonies on a fact-finding mission, announced:

“After meeting the Neo-Marlinists and the Marlinist Parliament, I have secured an agreement. The Landgrave of Mudhrid and his inner circle will cooperate fully with ACT to provide details on the senior leadership of the NMLA. In return, they will receive life imprisonment at a local detention facility.”

“The Steel Majesty’s population will undergo security vetting by the Marlinist Constabulary to identify extremists. The remainder will be permitted to remain in the system and apply for citizenship.”

Chancellor Blaine has approved the proposal, commenting that it was “precisely the sort of creative solution the Emperor requires”. Responses from the Alliance and Federation were mixed, but there was broad agreement that targeting the NMLA was the priority.

Minister Aaron Whyte, elected leader of the Marlinism Reformation Party, publicly thanked Senator Scordato for negotiating a peaceful resolution.

The Proactive Detection Bureau, which monitors all civilian communications in the Federation, has detected several home-grown terrorist groups.

Deputy Director Bethany Blake of the Federal Investigations Agency told the media:

“Our combination of sophisticated algorithms and skilled operatives has unearthed over a dozen extremist organisations, all previously unknown. The FIA launched pre-emptive raids on these groups before they were able to strike against civilian targets.”

“In addition, we have arrested several thousand individuals who were conducting research into terror tactics, radical ideologies and other suspicious subjects.”

“The PDB will continue monitoring all comms networks, and liaising with local security agencies via the Federal Justice Department.”

Vice President Jerome Archer hailed these results as validation of the Domestic Counter-Terrorism Act, and stated that the PDB will help prevent the mass murder of Federal citizens.

Civil rights groups have claimed that these extremists could have been detected via conventional policing methods, rather than intercepting personal messages. Independent criminologists added that the statistical likelihood of such amateur groups committing actual attacks is low.

Pilots Federation ALERT

An initiative by the Kumo Crew syndicate to construct new starports for increasing trade has ended successfully.

Pilots delivered large quantities of ceramic composites, semiconductors, polymers and water purifiers to Gabriel Enterprise in the Harma system. Bounty vouchers were also offered to protect the shipments during transit.

The Kumo Council has announced that rewards for both traders and bounty hunters are now available from Gabriel Enterprise via its loyal intermediaries, The Razor Whips.

Kavanagh Spaceframes Ltd will now fulfil its contract and construct new Orbis starports. These will be in place on the 29th of April 3307 at the following locations:

Pegasi sector PN-T C3-14, near the Harma system

HIP 18390, near the California Nebula

HIP 10792, near the Sothis system

HIP 62154, in the Coalsack Nebula

Eol Prou PC-K c9-91, in the Colonia region

A statement from Archon Delaine was published by The Pegasi Sentinel:

“I am pleased to see that our trade routes can now extend into fresh territories. My people will be very grateful, I’m sure.”

“What pleases me less is the huge number of criminal scum that tried to disrupt the project. This has forced me to invent some very creative reprisals, which I look forward to inflicting shortly.”

Shadow President Felicia Winters has claimed that the Proactive Detection Bureau is unconstitutional as it violates the Federal Accord.

In an address before Congress, she said:

“The Federation’s constitution explicitly guarantees citizens the right to data security and privacy. The PDB tramples over this by raiding everyone’s personal communications, casting aside decency and dignity so that algorithms can probe into every aspect of our lives.”

“Furthermore, if ACT’s hypothesis is correct and the NMLA is using an advanced dark-comms network, then the PDB’s existence is baseless and unjustifiable.”

Vice President Jerome Archer responded:

“The Domestic Counter-Terrorism Act is emergency legislation that temporarily suspends constitutional statutes, until we are satisfied that the terrorist threat has been negated.”

“Following the PDB’s success in uncovering extremist groups, we are widening the search parameters to include other related criminal activity.”

Opinion polls suggest that a slim majority of Federal citizens accept that some liberties must be sacrificed in return for increased security.

However, according to the civil rights organisation Advocacy, the speed with which the PDB gained access to data hubs suggested that “The infrastructure was already in place – all the government needed was an opportunity to make it legal.”

Imperator Hadrian Augustus Duval of Nova Imperium is the mastermind behind the NMLA, according to classified information leaked from within ACT.

Independent journalist Flint ‘Firemaker’ Lafosse published the details on the Rewired network:

“Hadrian Duval: the illegitimate embarrassment of the Imperial Family, or their secret terrorist nemesis? That’s the story being told by survivors from the Neo-Marlinist Order of Mudhrid, who gave up their secrets to save their own skins.”

“According to my source, Landgrave Delacroix confessed to ACT that his faction transported enzyme bombs and Nova Imperium assassins to their targets on the direct orders of Hadrian Duval, who promised rewards and political power in return.”

“Delacroix also revealed that Hadrian was converted to Neo-Marlinism a year ago by his consort Astrid Minerva, a top NMLA agent. She convinced him that becoming Emperor would be much easier if all the other Duvals were dead!”

“As for the NMLA’s attempt on Hadrian’s life last October, that was faked in order to gain the Imperial Family’s trust. Just another false flag operation – which, as we truth-seekers know, can be found everywhere.”

As yet this information has not been verified, and its source remains anonymous. There has been no comment from either ACT or Nova Imperium.

Francesca Wolfe of the Wallglass Investigations Agency examines the Hesperus megaship and the Dredger Clan that caused its recent discovery.

“When the Adamastor derelict received a strange signal, smart money was on it originating from its sister ship, the Hesperus. Both were owned by Azimuth Biochemicals and had vanished 200 years ago.”

“After a united effort to decode and trace the signal, independent pilots located the Hesperus in an asteroid belt around the second star of the Perseus Dark Region KC-V C2-2 system. Like the Adamastor, it was devoid of life – but not alone.”

“Alongside it was a dredger, whose proximity had triggered the Hesperus’s mayday. This was a rare sighting of a Dredger Clan, one of the nomadic tribes that Gunnarson recently discussed.”

“The Scriveners Clan was originally a fleet of research vessels for a long-forgotten academic consortium. Over centuries they became a self-sufficient society, constantly acquiring materials and information. They’re not aggressive, but shun outsiders and jealously guard their ‘Knowledge Core’. I’m fascinated by mentions of research-sergeants and lector-generals, suggesting their culture is a merger of scholastic and military.”

“With the Hesperus claimed as salvage by the Scriveners and its drives stripped, all chance of learning more was lost. Luckily, four encoded data files had resisted upload, and a gap in the dredger’s antiquated firewalls allowed pilots to hack them.”

“The decrypted logs have now been preserved for posterity in a nearby tourist beacon. They tell a disturbing story of corporate rivalry, murder and revenge, but also leave many unanswered questions...”

“We know that survivors abandoned ship to continue searching for ‘alien artefacts’. Did they all die in space or did they find something? What did Azimuth’s probes detect back in 3113? And who the hell is ‘Salvation’, the shadowy figure who contacted pilots to find the Hesperus?”

ACT has confirmed receiving evidence that NMLA attacks were orchestrated by Imperator Hadrian Augustus Duval, who immediately denied the claim.

Landgrave Delacroix of the Neo-Marlinist Order of Mudhrid provided details to ACT that the isolationist group Nova Imperium is at the heart of the NMLA. In response, Hadrian Duval made this statement:

“These accusations are completely false. Our political stance is the exact opposite of Marlinism, since we believe in restoring the Empire’s traditions. Nova Imperium forces even fought against the terrorists in Mudhrid, as required by the Treaty of Paresa.”

“As for Lady Astrid being a ‘top NMLA agent’, my wife has been a loyal Imperial Commander since she first piloted a ship.”

Princess Aisling Duval has publicly decried the allegation and offered support to Hadrian Duval. However, Senator Zemina Torval told the Senate:

“Should we be surprised that an extremist organisation performs extreme acts? That this arrogant boy who declares himself ‘Imperator’ should turn to violent rebellion once again? Enemies of the Empire must be punished, even those with Duval blood.”

ACT is fully investigating the Landgrave’s evidence and has asked for patience, despite urgent demands for action from the Alliance, Empire and Federation.

Pilots Federation ALERT

Aegis’s anti-xeno research programme has launched with the mass delivery of artefacts constructed by the Guardians.

Many ancient caskets, orbs, relics, tablets, totems and urns were found in the ruins of the mysterious civilisation that collapsed over a million years ago. Pilots then transported these to the Delphi system for analysis.

Professor Alba Tesreau made this announcement:

“Everyone at Aegis is thankful for the impressive effort made by the galactic community. If we can gain new insights into Guardian technology from these samples, then funding and resources for our work may continue.”

Aegis has agreed to pursue the development of weaponry and defences that might prove more effective against the Thargoids. However, as yet the research is in its early stages and there are no signs of imminent breakthroughs.

Pilots who delivered Guardian artefacts can now collect their rewards from Aegis Research at the Alexandria megaship in the Delphi system.

Pilots Federation ALERT

Data deliveries are required by competing initiatives to increase or decrease civilian surveillance in the Federation.

President Zachary Hudson has asked the public to contribute to making the Proactive Detection Bureau more effective:

“The PDB requires access to lesser-known comms channels where terrorists and criminals lurk. Supplying it with data from multiple sources will allow us to root out more potential threats.”

To counter this campaign, Shadow President Felicia Winters aims to protect personal communications from being intercepted:

“My duty is to help citizens preserve their constitutional right to privacy. If enough data can be gathered for baseline testing, we will distribute legal technology and techniques to secure against government intrusion.”

Both campaigns require deliveries of the following data types: anomalous bulk scan data, exceptional scrambled emission data, specialised legacy firmware and unusual encrypted files.

To support President Hudson, pilots should deliver data to Gresley Dock in the Nanomam system.

To support Shadow President Winters, pilots should deliver data to Ito Orbital in the Rhea system.

Political analysts believe that since Hudson and Winters are organising these projects personally, there may be repercussions for the security and stability of the systems where each has influence.

Pilots Federation ALERT

Five new starports constructed by Archon Delaine’s recent campaign have now become fully operational.

The Orbis stations, which are run by the Kumo Council faction, are listed below:

Kumo City in the Pegasi sector PN-T C3-14 system (Harma region)

California Freeport in the HIP 18390 system (California Nebula)

Crimson Exchange in the HIP 10792 system (Sothis region)

Fort Xeno in the HIP 62154 system (Coalsack Nebula)

Delaine Terminus in the Eol Prou PC-K c9-91 system (Colonia region)

The starports will provide a full range of services, although their low populations bring concerns that they may be under-staffed. Additionally, security agencies in nearby systems expressed fears that since they are operated by the Kumo Crew syndicate, they are likely to harbour black markets and promote illegal activity.

Arch-Corsair Kay Volantyne, a senior member of the Kumo Council, addressed this when she told The Pegasi Sentinel:

“These starports exist solely to encourage trade, which is the lifeblood of our galaxy. Sometimes a little lifeblood can get spilled here and there, so I’m sure our new neighbours will welcome our protection, yes?”

Other factions have appeared in the five systems, including subsidiaries of Sirius Corporation. Several newsfeeds have speculated about an ambiguous connection between the syndicate and the megacorp, whose financial support might explain how the Kumo Crew managed to extend so far beyond its territory.

The isolationist group faces attack by both Federal and Imperial factions, after accusations that Imperator Hadrian Duval is the NMLA mastermind.

The League of Mandu arrived in the Paresa system last week and quickly established a foothold. Admiral Natalia Lee, commanding the Harmony’s Shield megaship, announced:

“Our purpose is to eliminate the terrorists who slaughtered so many Federal citizens. We advise the Empire to stand aside and allow us to deliver justice.”

Magister Julius Halstrom of the Peraesii Empire Consulate declared:

“In the name of the Emperor, we stand ready to purge the NMLA from the Paresa system – and the Federation too, unless they withdraw.”

Hadrian Duval has broadcast a message via Paresa News Network:

“The NMLA faked my identity when dealing with the Neo-Marlinist Order of Mudhrid, knowing the superpowers would do their work for them by killing another Duval. Nova Imperium will defend itself if necessary, but we are not responsible for any terrorist attacks.”

ACT is still attempting to corroborate evidence provided by the Landgrave of Mudhrid. Praetor Leo Magnus, Nova Imperium’s security chief, is reportedly aiding their enquiries.

The Senate has urgently requested direction from the Emperor, but Chancellor Blaine declared “Her Majesty cannot pass judgement upon a live investigation.”

Pilots Federation ALERT

President Zachary Hudson’s call for data deliveries has enhanced civilian surveillance within the Federation.

His campaign received more data than a competing request from Shadow President Felicia Winters, which aimed to offer ways of protecting communications against interception by the Proactive Detection Bureau.

For both initiatives, pilots delivered anomalous bulk scan data, exceptional scrambled emission data, specialised legacy firmware and unusual encrypted files.

President Zachary Hudson hailed this show of public support for the Federal government:

“Our citizens deserve security, and with their contributions to the PDB’s databases, we are now in a better position to protect them against terrorism.”

Analysts predict that this outcome will boost security for systems that fall within Hudson’s personal sphere of influence. It is also expected that a loss of public support will reduce stability within systems where Winters has authority.

Pilots who supported President Hudson can now collect their rewards from Gresley Dock in the Nanomam system.

Pilots who supported Shadow President Winters can now collect their rewards from Ito Orbital in the Rhea system.

Pilots Federation ALERT

Open warfare has begun in the Paresa system between Nova Imperium and the League of Mandu, a Federal faction.

Imperator Hadrian Augustus Duval has been accused of masterminding the NMLA starport bombings, according to evidence provided to ACT.

Admiral Natalia Lee, commanding the Harmony’s Shield megaship, declared:

“The Empire refuses to arrest a Duval, even when he and his organisation are brutal terrorists. In the name of the hundreds of thousands of Federal citizens they murdered, we will enact justice.”

Hadrian Duval made an announcement from Dyson City, the home station of Nova Imperium:

“This invasion of Imperial space is based on false information. The Federation does not have the right to act as our judge, jury and executioner. I call upon the Empire to come to our defence, as stipulated in the Treaty of Paresa.”

Nova Imperium is an isolationist group that believes in retaining Imperial traditions and severing all ties with other superpowers. Hadrian Duval is the illegitimate grandson of Emperor Hengist, whose heritage was officially acknowledged last November.

ACT is currently working to verify claims that the Neo-Marlinist Order of Mudhrid aided the NMLA on Imperator Duval’s instructions.

Pilots Federation ALERT

The enigmatic ‘Salvation’ has sent a message to the Commanders he recently recruited to discover the Hesperus megaship.

The vessel was found in the Perseus Dark Region KC-V C2-2 system, after ‘Salvation’ provided an access key to read its automated SOS. Pilots were then encouraged to deliver any surviving logs to Taurus Mining Ventures at the Hind Mine asteroid base in the T Tauri system.

Patience Middleton, a representative of the corporation, announced:

“‘Salvation’ has authorised us to offer two million credits or ten units of void opals for delivering the Hesperus’s logs. This contract ends on the 21st of May 3307, after which payments will not be available.”

“We have been asked to relay the message below.”

“‘This is Salvation. I call myself this as I cannot yet reveal my identity, but my scientific breakthroughs will literally save all of humanity. The Adamastor and the Hesperus were just the beginning, as I have always known. For my intrepid agents, there will be further work to come.’”

Little is known about Taurus Mining Ventures, and ‘Salvation’ remains anonymous. Commanders are therefore being cautioned against undertaking tasks for a potentially criminal organisation.

The election of the Alliance prime minister will take place on the 27th of May, having been postponed due to the Galactic Summit.

Vanya Driscoll, political correspondent for The Alliance Tribune, reported:

“Prime Minister Edmund Mahon’s decision to postpone the election for three months caused enormous disruption and mass protests. This may have mortally wounded his campaign to be re-elected as head of government for a second six-year term.”

“With hindsight it’s clear that Mahon was prioritising the Sirius Treaty, a detailed proposal to unite the superpowers against the Thargoids. Unfortunately, the Galactic Summit was prematurely halted by the ‘Nine Martyrs’ bombings before the treaty could be agreed.”

“Although there are several candidates, Mahon’s only serious challenger is Councillor Nakato Kaine. She has been a vocal critic of his expansionist policies, and gained much public support for her focus on boosting trade between Alliance systems.”

“Electoral votes will be cast by members of the Alliance Assembly, whose decisions reflect popular opinion in their constituencies. No previous prime minister has served more than a single term, so it remains to be seen whether Mahon will defy precedent or Kaine will follow the pattern of history.”

There are widespread fears that current hostilities in the Paresa system may force the Empire and Federation to declare full-scale war.

The situation has been covered by mainstream media.

The Imperial Herald: “Hadrian might be the black sheep of the Duval family, but should he die by Federation hands, honour would demand retribution. Already the Imperial Navy is mobilising in anticipation of the Emperor’s reaction.”

The Federal Times: “The evidence that Nova Imperium orchestrated the starport bombings is credible, but the possibility of subterfuge remains. Could the NMLA really fake so many orders from Hadrian Duval to such a believable standard?”

Eye on Achenar: “An attack against a Duval is an attack against us all, even if he does turn out to be a terrorist. How dare those Fednecks try to judge our criminals for us!”

Sol Today: “Hundreds of thousands dead, half a million wounded… our people deserve retribution. But as usual, all the Imposers care about is pandering to their monarchy.”

Paresa News Network: “The death toll is soaring as full-blown battles rage through our system. Paresans are terrified at facing conquest by the Federation. Can we rely on the Empire to save us?”

Pilots Federation ALERT

The conflict in the Paresa system has ended with Nova Imperium defeating the Federal-backed League of Mandu faction.

Imperator Hadrian Augustus Duval had been targeted following accusations that he controlled the NMLA paramilitary group. He delivered a public address:

“Our hard-earned victory brings great honour to all who fought against the Federation’s invasion. Their arrogance justifies our long-held belief that the Empire must stand apart from other superpowers, but Nova Imperium will continue to serve in the fight against terrorism. Memento Mordanticus!”

Ambassador Catherine Carlisle of the Federal Diplomatic Corps made this statement:

“Although we are grateful for their zeal in combatting the NMLA, our intermediaries at the League of Mandu have acted hastily and will soon depart from Imperial space.”

Pilots who fought for Nova Imperium can now collect their rewards from Dyson City in the Paresa system.

Pilots who fought for the League of Mandu can now collect their rewards from Harmony’s Shield in the Paresa system.

Pilots Federation ALERT

Thargoid forces have invaded the Delphi system and several systems in the California, Coalsack and Pleiades Nebulas.

Huge numbers of Thargoid scouts and interceptors have appeared within multiple systems. Aegis has mobilised available defences, but also requested assistance from anti-xeno squadrons and independent pilots in combating the Thargoids.

Shipments of Guardian artefacts were recently delivered to the Delphi system as part of an Aegis research programme. Professor Alba Tesreau has speculated that the Thargoids’ well-documented aversion to Guardian technology may be the reason why Delphi was targeted.

Two starports recently constructed by the Kumo Crew syndicate – California Freeport in the HIP 18390 system and Fort Xeno in the HIP 62154 system – are among those seriously damaged by the assault. Archon Delaine, the syndicate’s warlord, announced:

“I’m not going to let these filthy aliens tear down what we’ve only just built. We need to teach them a lesson that even they will understand!”

All attacked stations have called upon the galactic community for help with rescuing their populations.

The Proactive Detection Bureau, which monitors all civil communications in the Federation, has received a boost from the galactic community.

President Hudson’s campaign for additional data proved so successful that the PDB has dramatically increased the range of its surveillance.

Deputy Director Bethany Blake of the Federal Intelligence Agency announced:

“We are now able to discreetly scan almost every private and public communications network used within Federal systems. As a result, arrest rates have soared and several organised crime rings have been dismantled.”

Shadow President Winters’s efforts to distribute methods of blocking the PDB received considerable support, but failed to eclipse Hudson’s initiative. This was interpreted by the Federal government as a mandate from the citizens to continue its surveillance programme.

Rhiannon Grady, director of the civil rights organisation Advocacy, told the media:

“Since the vast majority of citizens will never receive a visit from the FIA for their activities, the public has no sense of what they have lost. But history teaches us how hard it is to regain freedoms once you’ve given them away. The Federation has taken a large step toward becoming an interstellar police state with little regard for the individual.

The front-runner candidates in the Alliance election have stepped up their campaigns, amid widespread political and civil unrest.

Prime Minister Edmund Mahon and Councillor Nakato Kaine are touring across the Alliance, gathering public support to sway the Assembly when it votes on the 27th of May.

Attending a business sector conference on the planet Industry in the Zaonce system, Prime Minister Mahon stated:

“We’ve heard a lot of reactionary rhetoric from Councillor Kaine, but it’s much easier to be critical than constructive. She has done little to secure the prosperity of our people and companies, which was my primary focus over the last six years.”

At a protest march on New Caledonia in the Alkaid system, Councillor Kaine addressed the crowd:

“Again, the Thargoids lash out at our presence. Again, we prop up the other superpowers. Again, we pump money into Aegis and Lakon but not our own economies. Nothing changes, unless Mahon is voted out and the Alliance takes a new direction!”

Opinion polls suggest that Mahon has retained majority support, but with a narrower margin than in February when the election was originally scheduled. Many agree with Kaine that the Alliance should not have participated in the Galactic Summit, which led to the ‘Nine Martyrs’ bombings.

Pilots Federation ALERT

Prime Minister Edmund Mahon and Councillor Nakato Kaine have launched rival delivery initiatives in Alliance space.

The two leading candidates for Alliance prime minister are attempting to gather public support, although the actual election will be determined by votes within the Assembly on the 27th of May.

Every opinion poll suggests that Mahon’s victory is all but confirmed, which will grant him a second six-year term. However, the outcomes of these community drives will directly affect the successful candidate’s policies once in office.

Prime Minister Mahon is focusing on increasing industrial materials to aid expansion. He has requested that shipments of ceramic composites, polymers and superconductors are delivered to Dublin Citadel in the Gateway system.

Councillor Kaine aims to support local manufacturers in order to boost trade. She has asked for supplies of copper, micro-controllers and polymers to be delivered to Brett High in the Tionisla system.

Whoever is most successful will run a second campaign the following week. Mahon will launch a tritium mining initiative, leading to the construction of new Alliance starports. Kaine will use void opal mining to help stimulate trade, increasing the availability of rare goods in Alliance-controlled systems.

Pilots Federation ALERT

The Alexandria megaship has jumped from Delphi to the HIP 16538 system, triggering a Thargoid attack.

The megaship is carrying large quantities of Guardian artefacts, which were delivered as part of a research programme by Aegis.

Captain Jacob Morales, commanding officer of the Alexandria, has broadcast an SOS:

“This is an emergency! We scheduled a stopover in HIP 16538 for tritium refuelling en route to the Sol system, but Thargoid interceptors came swarming in within minutes. We require immediate assistance!”

Admiral Aden Tanner, Chief Military Liaison for Aegis, announced:

“We believe that the Thargoids are reacting to the concentrated presence of Guardian technology stored within the Alexandria’s cargo holds. Not only has the attack placed its crew and the population of this system in danger, but we risk losing these extremely valuable research materials.”

“Aegis is asking anti-xeno squadrons and independent pilots to help destroy all Thargoid vessels within HIP 16538 and protect the Alexandria.”

Evidence that Imperator Hadrian Augustus Duval masterminded the NMLA terror campaign cannot be authenticated, according to ACT.

Inspector Mara Klatt, one of ACT’s joint leaders, delivered this report:

“We have rigorously analysed data provided by the Landgrave of Mudhrid that contains detailed instructions from Hadrian Duval. The content undoubtedly arranges the starport bombings, but its source is inconclusive. It now seems highly plausible that his identity was faked by the NMLA.”

Hadrian Duval made an announcement via the Paresa News Network:

“There can no longer be any doubt that the NMLA planted a false trail in order to incriminate us. They aim to slay every Duval and demolish Imperial traditions, a goal that the Federation is clearly happy to support.”

“Lady Astrid and I are deeply grateful to the Nova Navy, and all the other pilots who helped to defend our honour.”

The Federal Diplomatic Corps confirmed that the League of Mandu, which was defeated by Nova Imperium, will withdraw from the Paresa system but made no reference to ACT’s report.

Praetor Leo Magnus, head of security for Nova Imperium and a former IISS officer, has been seconded to ACT. He will serve as a replacement for the deceased Captain Niamh Seutonia.

The Oracle starport in the Delphi system began tumbling out of orbit following a recent Thargoid attack.

The station was already ablaze and severely damaged by caustic enzymes during a Thargoid incursion in the Delphi system. This led to a cascading systems failure that shut down all of the station’s alignment thrusters.

As a result, the entire starport became affected by the gravity of Delphi 5 a, and began falling toward the moon. This immediately endangered the lives of tens of thousands of civilians.

Due to fire damage in the docking bay and the narrow timescale, evacuation of The Oracle’s entire population before it impacted upon the surface was considered impossible.

With only hours to go before collision, independent pilots risked their lives to rescue thousands of trapped civilians from the falling and damaged starport. This allowed the engineers to focus on patching up The Oracle’s alignment systems. The station is now considered to be in a stable orbit.

A spokesperson for Sirius Inc told the media:

“We are immensely grateful to those courageous Commanders for helping to prevent what could have been one of the most horrific disasters in modern history.”

Similar incidents have been reported at other stations that were targeted by the Thargoids, leading to speculation that this may not be coincidental. Unilateral plans to shore up this vulnerability in the starports are now underway.

The Alexandria megaship has been warned that it faces destruction if it attempts to travel to any Federal system.

The Aegis-owned vessel triggered a full-scale Thargoid incursion when it arrived in the HIP 16538 system. This seemed to be a reaction to the huge quantities of Guardian artefacts currently stored within its cargo holds.

Captain Jacob Morales, the Alexandria’s commander, broadcast this message:

“The Federal Navy has instructed us not to resume our scheduled journey to Sol or enter any system within the Federation. They’re treating us like a plague ship! I understand their concern that more Thargoids will follow us, but we have several thousand crewmembers who need to reach safe harbour.”

A strategy was outlined by Admiral Aden Tanner, chief military liaison for Aegis:

“We are attempting to clear the HIP 16538 system of Thargoid vessels, greatly aided by independent pilots and anti-xeno squadrons. The megaship will then jump to a system with a minimal population, where we will offload its cargo.”

Aegis has reiterated that the option to jettison the Alexandria’s cargo is a last resort, since the Guardian artefacts are vital to its research programme and cost billions of credits to acquire.

Pilots Federation ALERT

As the Assembly votes for its new leader, Prime Minister Edmund Mahon has requested mined tritium to aid expansion.

The new initiative follows on from his successful drive for industrial materials, which resulted in large amounts of ceramic composites, polymers and superconductors. Pilots who contributed to this can now collect their rewards from Dublin Citadel in the Gateway system.

A competing community drive by Councillor Nakato Kaine, Mahon’s main rival in the election, brought deliveries of copper, micro-controllers and polymers.

Prime Minister Mahon’s new tritium mining initiative aims to provide a stockpile of fuel to support the Alliance’s expansion programme. This will involve constructing up to five new starports, which are expected to be operational within a month.

Mined deposits of tritium can be delivered to Dublin Citadel in the Gateway system.

Members of the Alliance Assembly will gather today to cast their votes for a new prime minister. Opinion polls believe Mahon will comfortably win, although acknowledge that Kaine has broad support. The successful candidate will serve as the Alliance head of state for a six-year term.

The election for Alliance prime minister has been won by the incumbent Edmund Mahon, who begins a second six-year term in office.

The Alliance Assembly voted yesterday to elect the new head of state. Mahon received more votes than any other candidate, albeit not a majority of the electorate. Some council members demanded additional checks, causing a delay in announcing the results.

Prime Minister Mahon gave a victory speech to the public:

“It is my great honour to continue serving the diverse peoples of the Alliance. We will hold fast to our principles of democracy, prosperity and mutual defence, no matter what the galaxy throws at us.”

Vanya Driscoll, political correspondent for The Alliance Tribune, observed:

“With the core systems affected by political unrest, terrorist threats and economic turmoil, it is no surprise that the Assembly voted for stability. Mahon is a known quantity, and the Alliance has become reliant on his calm, measured leadership.”

The Core Dynamics breakaway faction created by ex-CEO Jupiter Rochester has survived, by gathering believers in the corporate rule of the Federation.

Conrad Sterling, political journalist for Vox Galactica, published this report:

“With its military forces defeated in February, and its leader found guilty of mass murder and imprisoned for life, Jupiter Division should now be a footnote in the Federation’s history.”

“Yet in recent months it has steadily grown, retaking control of HIP 54530 and several neighbouring systems. Its megaship, Victory’s Forge, even managed to repel Federal troops and remains under Jupiter Division’s command.”

“There is much speculation about the underlying reasons for this. Alongside general unrest with the Federation’s current policies, there is a rising interest in Rochester’s grand vision – replacing democracy with corporatocracy – among those wishing to see change. Many have flocked to Jupiter Division’s banner, preventing its collapse.”

“Core Dynamics, its parent company, has also continued to see defections within its ranks. However, new CEO Owen McKenna has vowed to destroy his predecessor’s rogue department. It is possible that Jupiter Division’s survival was only a brief reprieve, unless the corporatists can gather in sufficient numbers to sustain it.”

Pilots Federation ALERT

All independent ships aboard the Alexandria in the HIP 16538 system will be undocked on Thursday the 3rd of June.

The megaship triggered an invasion of Thargoid vessels when it arrived from the Delphi system. Aegis believes this was a reaction to the large quantities of Guardian artefacts being stored in its cargo holds.

Captain Jacob Morales, commanding officer of the Alexandria, outlined the next steps:

“On Thursday we will make a hyperspace jump to the HIP 30944 system. Since this has a small population, the risk of casualties will be low if the Thargoids continue to pursue us. Once there, we will arrange to offload our cargo and distribute it to multiple locations.”

“As a precaution, shortly before the jump we will uncouple all independent ships and leave them in the HIP 16538 system. We advise all pilots currently docked with the Alexandria to depart as soon as possible.”

The Alexandria was ordered not to enter any Federal systems, causing many newsfeeds to refer to it as a ‘plague ship’. There are widespread concerns that it will attract Thargoids to any system it travels to.

Pilots Federation ALERT

The corporate faction Jupiter Division is fighting for survival against the Silver Legal Group in the Ts'ao Tach system.

Jupiter Division was formed by rogue Core Dynamics departments loyal to ex-CEO Jupiter Rochester. Although it was defeated in February, a growing corporatist movement within the Federation has helped rebuild its strength.

A call to arms was made by Owen McKenna, the new CEO of Core Dynamics:

“Rochester’s deranged cult must be wiped out once and for all. We are supporting our ally, the Silver Legal Group, to destroy Jupiter Division’s fleet and allow us to retake our stolen resources.”

Vice-Executive Blanca Carbonell, a senior leader of Jupiter Division, broadcast this message:

“To all those seeking a better Federation – stand up and make your voice heard! Only direct corporate rule can end government corruption. Jupiter Division must survive to lead that change!”

Two megaships, Victory’s Forge and Iron Wings of Justice, are once again serving as the centres of operation for Jupiter Division and the Silver Legal Group.

Political commentators believe that this second conflict will be a decisive one, determining whether or not Jupiter Division can survive without its founder.

Pilots Federation ALERT

Prime Minister Edmund Mahon’s request for mined tritium has concluded, paving the way for new Alliance starports.

Large quantities of tritium were delivered, which will provide fuel for a civil infrastructure programme designed to increase the Alliance’s presence.

As part of this expansion, new Alliance starports will be constructed in these systems by the 25th of June 3307:

LHS 2522

Sharru Sector FW-W c1-19

Prime Minister Mahon, who was recently re-elected by the Assembly, told the media:

“The economy of the Alliance will benefit greatly from investment in expansion. These new stations will provide more opportunities for individuals and corporations alike.”

Pilots who mined and delivered tritium can now collect their rewards from Dublin Citadel in the Gateway system.

The Alexandria has failed to arrive in the HIP 30944 system as scheduled, and may have been hyperdicted by the Thargoids.

The Aegis-owned megaship triggered an attack by Thargoid vessels when it travelled from the Delphi system to HIP 16538 on the 20th of May. Aegis believes this was caused by the large quantity of Guardian artefacts in its cargo holds.

To reduce the risk of further casualties, the Alexandria plotted a route to a low-population prison colony in the HIP 30944 system. All independent ships were undocked before it made the hyperspace jump on the 3rd of June.

However, the megaship never reached its arrival point and all communication with it has ceased. Search teams in local systems have not detected its presence.

Admiral Aden Tanner, chief military liaison with Aegis, informed the media:

“We regret to announce a complete loss of contact with the Alexandria. Although there is no evidence of damage or destruction, its disappearance while travelling through hyperspace raises the possibility that it was intercepted en route by Thargoid forces.”

“Captain Jacob Morales and over four thousand crewmembers will be listed as missing presumed dead. In addition to this great tragedy, Aegis’s research programme into Guardian technology has been severely impacted by the loss of many precious artefacts.”

Minister Aaron Whyte, leader of the Marlinism Reformation Party, has confirmed that it aims to politically represent the Neo-Marlinist fringe.

At a meeting of the Marlinist Parliament, Minister Whyte declared:

“Not all of the Neo-Marlinist community seek a violent uprising to end the Duval family’s thousand-year dictatorship. We can help replace desperate acts of rebellion with meaningful dialogue and public pressure.”

Several newsfeeds observed that Whyte was attempting to rebrand Neo-Marlinism as being closer to the mainstream ideals of Marlinism. However, the possibility that the faction may now act as the political wing of the NMLA has caused widespread alarm.

In related news, a recent election in the Hyades Sector RO-P b6-2 system saw voters remove the Marlinism Reformation Party from power, after it granted asylum to survivors from the Neo-Marlinist Order of Mudhrid.

The system’s new leader, Minister Octavia Volkov of the Exiled Marlinist Assembly of Baltah'Sine, announced:

“My party believes in following Marlin Duval’s example by building independent democracies, rather than reforming the Empire. However, three of our colony systems have already fallen under the control of foreign factions. We urgently need support to keep the dream of a Marlinist Republic alive.

Pilots Federation ALERT

The corporate faction Jupiter Division has been defeated by the Silver Legal Group in the Ts'ao Tach system.

The breakaway faction from Core Dynamics was unable to resist efforts by its parent company to recover ships and resources. Jupiter Division will soon be subsumed by Core Enterprises, a subsidiary of Core Dynamics.

Owen McKenna, the CEO of Core Dynamics, declared:

“Thanks to the Silver Legal Group and other loyal allies of the Federation, we have finally crushed this criminal enterprise. Let this be an end to the delusions of Jupiter Rochester.”

Many newsfeeds believe that Jupiter Division’s defeat will have a negative impact on the corporatist movement that has recently emerged within some Federal systems.

Director Theodore Sullivan of the Silver Legal Group confirmed that those who fought on their side can now collect payments from the Iron Wings of Justice megaship in the Ts'ao Tach system.

Pilots Federation ALERT

Commanders in the Chukchan and Perseus Dark Region KC-V c2-2 systems have reported being contacted by ‘Salvation’.

The anonymous individual is known to have an interest in the Adamastor and the Hesperus, the ‘ghost ships’ within those systems. Both of the derelict megaships were operated 200 years ago by Azimuth Biochemicals.

Commander Tyler Thorsen told Vox Galactica:

“I was taking some sightseers on a trip round the Hesperus, and getting as close as I dared to the Scriveners Clan dredger. I scanned the tourist beacon for them, and suddenly received a direct message from this ‘Salvation’ guy.”

“He asked me to track down some old signal beacons, which are listening posts configured to retransmit long-range comms. Apparently these could help locate the survivors from the megaship. But the Hesperus is ancient history. Surely there can’t be anything or anyone left to find?”

In April, ‘Salvation’ unofficially recruited independent pilots to locate the Hesperus, and to deliver its surviving logs to Taurus Mining Ventures.

The Pilots Federation is running an inquiry into ‘Salvation’ and his associates. Commanders are being cautioned against undertaking tasks for what may be an illegal enterprise.

The Affiliated Counter-Terrorism unit has published an update on its investigation into the Neo-Marlinist Liberation Army.

Senior Agent Tanya Ramirez, one of ACT’s joint leaders, gave a statement to the media:

“ACT is currently pursuing multiple lines of enquiry, which must remain classified for reasons of security. Our agents are gathering evidence from sites across the Alliance, Empire and Federation.”

“As yet we cannot report any significant breakthroughs. NMLA activists appear to use a dark-comms network that defies detection. They also compartmentalise their operations, so individual cells have little knowledge of each other.”

“In recent months, NMLA incidents have been restricted to minor strikes against Imperial authorities, which were dealt with by local police forces. There has been no activity by Theta Group, the hardcore extremists responsible for the ‘Nine Martyrs’ starport bombings.”

“The collapse of the Neo-Marlinist Order of Mudhrid may have deprived the NMLA of their logistical capability to deliver large-scale attacks. But it remains possible that a new wave of terrorist atrocities is being planned.”

ACT later confirmed that it has recruited additional personnel from Alliance Interpol, the Federal Intelligence Agency, the Imperial Internal Security Service, the Marlinist Constabulary, Nova Imperium’s Praetorian Guard and the Wallglass Investigations Agency.

The galaxy’s largest megacorporation is continuing to influence the political arena and affect billions of lives.

A review was published by Marlon Royce, business analyst for Vox Galactica:

“With its own government, laws and naval fleet, it’s not surprising that Sirius Corporation is occasionally referred to as ‘the fourth superpower’. That now seems to be its actual goal, as its impact upon interstellar politics increases.”

“When Sirius Corporation resettled the Marlinist refugees in their own colony systems, it averted war between the Empire and the Federation. But this seemingly altruistic move enabled CEO Li Yong-Rui to claim political neutrality, gaining public support to host the Galactic Summit in the Sirius system.”

“That success was undermined by the controversy of granting diplomatic status to pirate warlord Archon Delaine. Rumours of secret business dealings were reinforced when Sirius subsidiaries appeared alongside the Kumo Crew’s new starports.”

“High-level agreements were also made with the Alliance, with Sirius Atmospherics aiding colonisation of the Coalsack Nebula. But some believe that its project to terraform ammonia worlds brought retaliatory strikes from the Thargoids and enormous casualties.”

“The latest news is of a collaboration with technology brokers to make a previously limited ship module commercially available. Is this a shrewd business decision, or part of Sirius Corporation’s strategy of political dominance?”

Councillor Nakato Kaine has suggested that the Alliance’s current electoral system should be replaced by direct public voting.

The proposal follows a recent election where Prime Minister Edmund Mahon was reinstated for a second six-year term.

Addressing the Alliance Assembly, Councillor Kaine said:

“Only allowing council members to choose the prime minister is a flawed system, vulnerable to corruption and outside influence. The people of the Alliance should have a direct mandate to determine their leader by casting individual votes.”

Political journalist Vanya Driscoll reported for The Alliance Tribune:

“Although Kaine stopped short of claiming that Mahon’s victory was achieved fraudulently, the Assembly took a dim view of this attempt at electoral overhaul. Some council members accused her of failing to accept that her policies received considerably less support than those of her rival.”

“Despite this, a few accepted that there could be merit in such a restructure. However, organising public voting across all Alliance systems would be much harder than in democracies with a more established infrastructure, such as the Federation, or that have smaller populations, such as the Marlinist Colonie

Pilots Federation ALERT

Sirius Corporation has requested commodities to make a fully engineered detailed surface scanner commercially available.

The ship module was produced in limited numbers during a terraforming programme campaign by Sirius Atmospherics in late 3306. It was awarded to pilots who provided data on worlds with ammonia-based atmospheres for its terraforming programme.

Sinclair Faraldo, marketing director for Sirius Corporation, provided details:

“Following a feasibility study, we have determined that this module can be economically mass produced for general sale. Our fully engineered detailed surface scanner has twice probe coverage, allowing planets and moons to be mapped more efficiently.”

“In order to begin production, we require large quantities of CMM composites, muon imagers and synthetic reagents. We will generously reward pilots who can deliver these to Ashby City in the Luyten’s Star system.”

The Engineered Detailed Surface Scanner V1 will be available for purchase at all human technology brokers, assuming that sufficient quantities of commodities can be obtained.

Pilots Federation ALERT

An Anaconda from the Hesperus megaship has been found at a historical battlefield on the moon Trapezium Sector YU-X c1-2 1a.

The discovery was made by pilots who tracked down a series of signal beacons, following instructions provided by the anonymous ‘Salvation’. The beacons were deployed by the Hesperus during its voyage nearly 200 years ago.

The Anaconda, named Proteus, was one of the megaship’s secondary vessels and had been outfitted for long-range exploration. It was used by an Azimuth Biochemicals science team to flee the Hesperus after the megaship was overtaken by saboteurs from rival company Pharmasapien.

Upon landing, the Proteus was converted into a research facility to study the ancient structures and wreckage on the moon. The proximity of both Guardian and Thargoid technology suggests this was the site of a battle fought by the two civilisations over a million years ago, although in 3113 neither species had yet been identified.

Professor Alba Tesreau of Aegis Research gave this statement:

“This is a significant xenoarchaeological find – physical evidence of the war between the Guardians and the Thargoids. Our advance teams are conducting preliminary surveys, and a megaship is being prepared. Following the Alexandria’s tragic disappearance, we hope this may serve as a fresh source of Guardian artefacts for our anti-xeno research programme.”

The fall of Jupiter Division has undermined the popular movement calling for the Federation to be governed by corporations.

Conrad Sterling, political journalist for Vox Galactica, reported on developments:

“Core Dynamics’s recent victory in the Ts’ao Tach system dealt a severe blow to the corporatists. Many companies withdrew their support even before the last shot was fired, and plans for Jupiter Division to become the movement’s central organisation have been abandoned.”

“Sighs of relief were undoubtedly breathed through the corridors of power on Mars when this threat to the Federation’s democratic principles was defeated. And yet, despite Congress downplaying it and many Federal newsfeeds neglecting to cover the story, calls for a corporatocracy have not been completely silenced.”

“Citizens who seek an alternative to voting for either Hudson or Winters are still attracted to the idea. Would corporate rule be more honest? Opinions vary, but many supporters claim ‘big business’ already possesses true power behind closed doors.”

“It now seems that history will record this as a path not taken. With Jupiter Rochester imprisoned and Jupiter Division dissolved, replacement figureheads for the corporatist movement are unlikely to arise in time to preserve it.”

The Marlinism Reformation Party, which now represents the Neo-Marlinist fringe, has suggested a peace deal between the NMLA and the Empire.

Minister Aaron Whyte explained the proposal during a session of the Marlinist Parliament:

“Via anonymous intermediaries, we have received assurances that the Neo-Marlinist Liberation Army is keen to take advantage of our representation. I see this as a hugely positive step that will prevent further conflict.”

“In essence, the NMLA is offering reparations for the unfortunate casualties of its anti-authority activities within the Empire. In return, it requests a permanent presence in the Imperial Senate as a means of continuing political dialogue.”

Many other parliamentarians considered the proposal to be highly controversial. Minister Octavia Volkov declared:

“Providing the NMLA with a political wing, pretending they are reasonable people, suggesting they could pay off the families of everyone they’ve murdered… Whyte, you are an insult not just to Marlinism but to all humanity!”

First Minister Jenna Fairfax called for unity, insisting that the Marlinist Colonies must stand together to ensure their survival. However, she has officially requested that the Marlinism Reformation Party reverses its stance on negotiating with the NMLA.

Pilots Federation ALERT

Pilots have delivered commodities to enable Sirius Corporation to mass produce a fully engineered detailed surface scanner.

The enhanced ship module will shortly receive a commercial release, having previously only been available during a terraforming initiative by Sirius Atmospherics in late 3306.

The Engineered Detailed Surface Scanner V1 increases probe coverage to twice the normally achievable range, offering a more efficient mapping of planetary surfaces.

The project’s success was declared by Sinclair Faraldo, marketing director for Sirius Corporation:

“We are most grateful to all pilots who brought us shipments of CMM composites, muon imagers and synthetic reagents as requested. Mass production of the enhanced detailed surface scanner has already begun, and it will be available for purchase from human technology brokers very soon.”

All pilots who took part in this campaign can now collect payment from Sirius Corporation at Ashby City in the Luyten’s Star system.

Pilots Federation ALERT

Aegis Research and Taurus Mining Ventures have requested deliveries of Guardian artefacts to the PMD2009 48 system.

Their rival campaigns follow the discovery of an ancient battleground between the Guardians and the Thargoids on Trapezium Sector YU-X c1-2 1a.

Patience Middleton, representing Taurus Mining Ventures, broadcast this statement:

“‘Salvation’ has claimed the exclusive rights to exploit the Proteus site, which was only discovered because of his specialist knowledge. He has contracted us to pay for Guardian caskets, orbs, relics, tablets, totems and urns brought to the Glorious Prospect megaship.”

Aegis Research has also positioned a megaship, the Archimedes, in the PMD2009 48 system. Professor Alba Tesreau announced:

“It is vital that Aegis replaces the Guardian artefacts that were lost aboard the Alexandria. Without sufficient materials, our anti-xeno research programme will be severely hampered.”

“We recognise the risk that collecting Guardian technology on a megaship may attract the Thargoids, as happened in the Delphi system. However, this system is much farther from any known areas of Thargoid activity, so we hope to avoid drawing their attention.”

The Alliance, Empire and Federation consider depriving Aegis of resources to be a criminal act. As a result, pilots are warned that any ship modules received from Taurus Mining Ventures will be marked as ‘hot’, thereby incurring extra costs to be cleaned prior to installation.

Pilots Federation ALERT

Two Alliance stations have been constructed following a successful re-election campaign by Prime Minister Edmund Mahon.

Enterprise Market in the LHS 2522 system and Prosperity Core in the Sharru Sector FW-W c1-19 system are now fully operational. Prime Minister Mahon welcomed visitors to the new starports, promising that they would “further enhance the Alliance’s commitment to creating opportunities”.

However, Councillor Nakato Kaine triggered heated debate in the Alliance Assembly when she made this announcement:

“My investigation turned up irregularities in the tritium mining campaign, suggesting that it only received enough deliveries to allow one starport to be built. Furthermore, docking records seem to indicate that Sirius Corporation made up the shortfall with a number of unregistered donations.”

“Sirius Corporation now has a presence in the Sharru Sector FW-W c1-19 system. This suggests disturbing parallels with the company’s recent dealings to help build Archon Delaine’s new starports. The question is – what did Mahon promise in return?”

A statement from the Office of the Prime Minister clarified that Sirius Corporation was one of many companies currently partnered with the Alliance to support its expansion programme. It did not address the discrepancy in tritium deliveries or refer to any contributions from the megacorp.

A proposal for the Empire to formally open diplomatic relations with the Marlinist Colonies has been made by Senator Lorcan Scordato.

The eight systems are populated by ex-Imperial citizens who fled to avoid persecution for their beliefs in Marlinism, which advocates democratic representation.

Returning from a fact-finding mission to the colonies, Senator Scordato told the Senate:

“The Marlinist community is primarily focused on peaceful co-existence alongside the Empire, rather than trying to reform the Republic of Achenar. And now that Minister Aaron Whyte speaks for the Neo-Marlinists, we have an opportunity to prevent further extremist actions via diplomacy.”

Although some senators agreed, others such as Denton Patreus stressed that “As a matter of honour and principle, the Empire does not negotiate with terrorists.”

Several newsfeeds observed that both the Alliance and the Federation are looking into opening formal diplomatic channels with the Marlinist Colonies. Similar debates have occurred in the Assembly and Congress regarding the acceptance of an NMLA political wing.

First Minister Jenna Fairfax has repeated calls for the Marlinism Reformation Party to cease representing the Neo-Marlinist fringe. However, she also announced plans for a Marlinist equivalent to the Imperial Diplomatic Corps that would undertake ambassadorial duties.
 
Last edited:
Back
Top Bottom